Dataset for protein classical BH3-containing proteins of organism Chinchilla lanigera

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2UGS8_BBC3-01      --------------------------------------------------
A0A8C2W470_BAD-02       --------------------------------------------------
A0A8C2W470_BAD-01       --------------------------------------------------
A0A8C2VWH6_PMAIP1-      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      TRPGRRRSRQGTRRGQPRLYLSQPARAGSPRGAGAGLALPRAEAGLGGGG
A0A8C2VBL6_BMF-01       -MPRAGVFWKQYRAVCPGLLRARPPRRPPPAALGFPLLPHRV--------
                                                                          

A0A8C2UGS8_BBC3-01      ----------------------------------------MARARQEGSS
A0A8C2W470_BAD-02       --------------------------------------------------
A0A8C2W470_BAD-01       --------------------------------------------------
A0A8C2VWH6_PMAIP1-      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      ARGDWTRARSRQSELGCRAAQVSLRSAQPLGAELAGAQRPAPSPPPHHRR
A0A8C2VBL6_BMF-01       ----W-----------------------------------APSP------
                                                                          

A0A8C2UGS8_BBC3-01      PEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPTTTPALLPAAYL
A0A8C2W470_BAD-02       -------------------------------------MFQIPEFEPSEQE
A0A8C2W470_BAD-01       -----MRTPEKPSPAPTHAESLRKSEQGIRRLGAAQSMFQIPEFEPSEQE
A0A8C2VWH6_PMAIP1-      ---------------------------------------------MPGKV
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      QRILTVPLRALPHCSQHRLRQLQLPRSRRHRLGALPWPWYPQCLTLILEL
A0A8C2VBL6_BMF-01       -RVLVT-----------------------LDPGAEPWHHDSEADSLSWSH
                                                                          

A0A8C2UGS8_BBC3-01      CAPTAPPALTAALGGPRW----PGG-------PRSRPRGPRPDGPQPPLS
A0A8C2W470_BAD-02       DSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQRQLRSSSHHGGAGAMD
A0A8C2W470_BAD-01       DSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQRQLRSSSHHGGAGAMD
A0A8C2VWH6_PMAIP1-      CKSTPPPNSTRAPAELAAECAAQHRRIG----DKLNALGCATEILETLAE
A0A8C2UYE1_BCL2L11      --------MAKQPSDVSSECDTEGGQLQ----PAERPPQLRPGALTSLQT
A0A8C2UYE1_BCL2L11      --------MAKQPSDVSSECDTEGGQLQ----PAERPPQLRPGALTSLQT
A0A8C2UYE1_BCL2L11      RSARKKDQMAKQPSDVSSECDTEGGQLQ----PAERPPQLRPGALTSLQT
A0A8C2VBL6_BMF-01       PGEMEPPQCVE---------ELEDDVFQ----PEDGEPGTQPGSLLSADL
                                                                          

A0A8C2UGS8_BBC3-01      AAEQHLESP----------------------------VPSAPE-------
A0A8C2W470_BAD-02       TRSRHSSYPTGM--------------------EEEEGMEEEPS-------
A0A8C2W470_BAD-01       TRSRHSSYPTGM--------------------EEEEGMEEEPS-------
A0A8C2VWH6_PMAIP1-      MPGKKARK------------------------------------------
A0A8C2UYE1_BCL2L11      EPQDRSPAPMSC--------------------DKSTQTPSPPCQAFNHYL
A0A8C2UYE1_BCL2L11      EPQ-----------------------------------------------
A0A8C2UYE1_BCL2L11      EPQDRSPAPMSC--------------------DKSTQTPSPPCQAFNHYL
A0A8C2VBL6_BMF-01       FAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVML
                                                                          

A0A8C2UGS8_BBC3-01      ---ALAGGP-----------------------TQAAPG----VRGEEEQW
A0A8C2W470_BAD-02       ---PFRGRS-----------------------RSAPPN----L------W
A0A8C2W470_BAD-01       ---PFRGRS-----------------------RSAPPN----L------W
A0A8C2VWH6_PMAIP1-      ---SAQLTL-----------------------TGAPAE----L-------
A0A8C2UYE1_BCL2L11      SAMASMRQS-----------------------QAEPPD----L------R
A0A8C2UYE1_BCL2L11      ---ASMRQS-----------------------QAEPPD----L------R
A0A8C2UYE1_BCL2L11      SAMASMRQS-----------------------QAEPPD----L------R
A0A8C2VBL6_BMF-01       PCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLEEQPPEGQWQH------R
                                                           ..             

A0A8C2UGS8_BBC3-01      -AREIGAQLRRMADDLNAQYER---RRQEEQQRHRPSPW---------RV
A0A8C2W470_BAD-02       AAQRYGRELRRMSDEFVDSFKG---LPRPKSAGTATKLWQSSNWTRAIQS
A0A8C2W470_BAD-01       AAQRYGRELRRMSDEFVDSFKG---LPRPKSAGTATKLWQSSNWTRAIQS
A0A8C2VWH6_PMAIP1-      -EVECAAQFRRIGDKLNFR---------------------QKLMNLISKL
A0A8C2UYE1_BCL2L11      PEIWIAQELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRL
A0A8C2UYE1_BCL2L11      PEIWIAQELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRL
A0A8C2UYE1_BCL2L11      PEIWIAQELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRL
A0A8C2VBL6_BMF-01       AEVQIARKLRCIADQFHRL--------HMQQRQQNQNRVWWQVLLFLHNL
                             . ::* :.*.:                                . 

A0A8C2UGS8_BBC3-01      LYNLIMGLLPLPRGHGAPEMEPN
A0A8C2W470_BAD-02       WWDRNLG-----RGGSAPSQ---
A0A8C2W470_BAD-01       WWDRNLG-----RGGSAPSQ---
A0A8C2VWH6_PMAIP1-      FSLVT------------------
A0A8C2UYE1_BCL2L11      VWRMH------------------
A0A8C2UYE1_BCL2L11      VWRMH------------------
A0A8C2UYE1_BCL2L11      VWRMH------------------
A0A8C2VBL6_BMF-01       GLNGEENREGVGPR---------
                                               

© 1998-2023Legal notice