Dataset for protein classical BH3-containing proteins of organism Chinchilla lanigera

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2VBL6_BMF-01       --------------------------------------------------
A0A8C2UGS8_BBC3-01      --------------------------------------------------
A0A8C2W470_BAD-01       --------------------------------------------------
A0A8C2W470_BAD-02       --------------------------------------------------
A0A8C2UYE1_BCL2L11      TRPGRRRSRQGTRRGQPRLYLSQPARAGSPRGAGAGLALPRAEAGLGGGG
A0A8C2VWH6_PMAIP1-      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2VBL6_BMF-01       ----------------------------MPRAGVFWKQYRAVCPGLLRAR
A0A8C2UGS8_BBC3-01      ----------------------------------------MARARQEGSS
A0A8C2W470_BAD-01       --------------------------------------------------
A0A8C2W470_BAD-02       --------------------------------------------------
A0A8C2UYE1_BCL2L11      ARGDWTRARSRQSELGCRAAQVSLRSAQPLGAELAGAQRPAPSPPPHHRR
A0A8C2VWH6_PMAIP1-      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2VBL6_BMF-01       PPRRPPPAALGFPLLPHRVWAPSPRVLVTLDPGAEPWHHDSEADSLSWSH
A0A8C2UGS8_BBC3-01      PEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPTTTPALLPAAYL
A0A8C2W470_BAD-01       -----MRTPEKPSPAPTHAESLRKSEQGIRRLGAAQSMFQIPEFEPSEQE
A0A8C2W470_BAD-02       -------------------------------------MFQIPEFEPSEQE
A0A8C2UYE1_BCL2L11      QRILTVPLRALPHCSQHRLRQLQLPRSRRHRLGALPWPWYPQCLTLILEL
A0A8C2VWH6_PMAIP1-      ---------------------------------------------MPGKV
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2VBL6_BMF-01       PGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRL
A0A8C2UGS8_BBC3-01      CAPTAPPALTAALGG-----------------------PRW----PGG--
A0A8C2W470_BAD-01       DSSSEERGLGPGPTG-----------------------DRLGSNTAGGFL
A0A8C2W470_BAD-02       DSSSEERGLGPGPTG-----------------------DRLGSNTAGGFL
A0A8C2UYE1_BCL2L11      RSARKKDQMAKQPSD-----------------------VSSECDTEGGQL
A0A8C2VWH6_PMAIP1-      CKSTPPPNSTRAPAE-----------------------LAAECAAQHRRI
A0A8C2UYE1_BCL2L11      --------MAKQPSD-----------------------VSSECDTEGGQL
A0A8C2UYE1_BCL2L11      --------MAKQPSD-----------------------VSSECDTEGGQL
                                                                          

A0A8C2VBL6_BMF-01       HLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFY
A0A8C2UGS8_BBC3-01      -----PRSRPRGPRPDGPQPPLSAAEQHLESP--------VPSAPE----
A0A8C2W470_BAD-01       GDTSHQQRQLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEGMEEEPS----
A0A8C2W470_BAD-02       GDTSHQQRQLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEGMEEEPS----
A0A8C2UYE1_BCL2L11      Q----PAERPPQLRPGALTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C2VWH6_PMAIP1-      G----DKLNALGCATEILETLAEMPGKKARK-------------------
A0A8C2UYE1_BCL2L11      Q----PAERPPQLRPGALTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C2UYE1_BCL2L11      Q----PAERPPQLRPGALTSLQTEPQ------------------------
                                                                          

A0A8C2VBL6_BMF-01       GNAGYRLPLPASFPAGLPLEEQPPEG--QWQHRAEVQIARKLRCIADQFH
A0A8C2UGS8_BBC3-01      -------------ALAGGPTQAAPGVRGEEEQW-AREIGAQLRRMADDLN
A0A8C2W470_BAD-01       -------------PFRGRSRSAPPNL------WAAQRYGRELRRMSDEFV
A0A8C2W470_BAD-02       -------------PFRGRSRSAPPNL------WAAQRYGRELRRMSDEFV
A0A8C2UYE1_BCL2L11      -------HYLSAMASMRQSQAEPPDL------RPEIWIAQELRRIGDEFN
A0A8C2VWH6_PMAIP1-      -------------SAQLTLTGAPAEL--------EVECAAQFRRIGDKLN
A0A8C2UYE1_BCL2L11      -------HYLSAMASMRQSQAEPPDL------RPEIWIAQELRRIGDEFN
A0A8C2UYE1_BCL2L11      -------------ASMRQSQAEPPDL------RPEIWIAQELRRIGDEFN
                                     .        ..              . ::* :.*.: 

A0A8C2VBL6_BMF-01       -------------------RLHMQQRQQNQNRVWWQVLLFLHNLGLNGEE
A0A8C2UGS8_BBC3-01      AQYER---RRQEEQQRHRPSPW---------RVLYNLIMGLLPLPRGHGA
A0A8C2W470_BAD-01       DSFKG---LPRPKSAGTATKLWQSSNWTRAIQSWWDRNLG-----RGGSA
A0A8C2W470_BAD-02       DSFKG---LPRPKSAGTATKLWQSSNWTRAIQSWWDRNLG-----RGGSA
A0A8C2UYE1_BCL2L11      ASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH------------
A0A8C2VWH6_PMAIP1-      FR---------------------QKLMNLISKLFSLVT------------
A0A8C2UYE1_BCL2L11      ASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH------------
A0A8C2UYE1_BCL2L11      ASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH------------
                                                       .                  

A0A8C2VBL6_BMF-01       NREGVGPR
A0A8C2UGS8_BBC3-01      PEMEPN--
A0A8C2W470_BAD-01       PSQ-----
A0A8C2W470_BAD-02       PSQ-----
A0A8C2UYE1_BCL2L11      --------
A0A8C2VWH6_PMAIP1-      --------
A0A8C2UYE1_BCL2L11      --------
A0A8C2UYE1_BCL2L11      --------
                                

© 1998-2022Legal notice