Dataset for protein Bad of organism Chinchilla lanigera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                ************************************************
--------------------------------MFQIPEFEPSEQEDSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQR
mrtpekpspapthaeslrkseqgirrlgaaqs                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
QLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKS
                                                                                

       170       180       190    
....:....|....:....|....:....|....
**********************************
AGTATKLWQSSNWTRAIQSWWDRNLGRGGSAPSQ
                                  
© 1998-2022Legal notice