Dataset for protein Bad of organism Chinchilla lanigera

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2W470_BAD-01      MRTPEKPSPAPTHAESLRKSEQGIRRLGAAQSMFQIPEFEPSEQEDSSSE
A0A8C2W470_BAD-02      --------------------------------MFQIPEFEPSEQEDSSSE
                                                       ******************

A0A8C2W470_BAD-01      ERGLGPGPTGDRLGSNTAGGFLGDTSHQQRQLRSSSHHGGAGAMDTRSRH
A0A8C2W470_BAD-02      ERGLGPGPTGDRLGSNTAGGFLGDTSHQQRQLRSSSHHGGAGAMDTRSRH
                       **************************************************

A0A8C2W470_BAD-01      SSYPTGMEEEEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVD
A0A8C2W470_BAD-02      SSYPTGMEEEEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVD
                       **************************************************

A0A8C2W470_BAD-01      SFKGLPRPKSAGTATKLWQSSNWTRAIQSWWDRNLGRGGSAPSQ
A0A8C2W470_BAD-02      SFKGLPRPKSAGTATKLWQSSNWTRAIQSWWDRNLGRGGSAPSQ
                       ********************************************

© 1998-2022Legal notice