Dataset for protein Bad of organism Chinchilla lanigera

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2W470_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chinchilla lanigera GN=BAD (length=194 residues).
MRTPEKPSPAPTHAESLRKSEQGIRRLGAAQSMFQIPEFEPSEQEDSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQR
QLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKS
AGTATKLWQSSNWTRAIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A8C2W470_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chinchilla lanigera GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSEERGLGPGPTGDRLGSNTAGGFLGDTSHQQRQLRSSSHHGGAGAMDTRSRHSSYPTGMEEEEG
MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSNWTRAIQSWWDRNLGRGGSAP
SQ
© 1998-2022Legal notice