Dataset for protein Bim of organism Cebus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . :   . ..    .* :..  . :                             
ifvrrssvlsrsssgyfsfdtDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMasmrqsqae-----------qelrrig--
---------------------asmrqsqaepagmrpeiwia elrrigdefgdyy-----pagmrpeiwia-------de
                                                   vrwtprvlvi lr evq pvlwfassteq
                                                   niisgesvg           kl sqgs  
                                                   defie r a           e   k    
                                                    aee                         
                                                     aa                         

       170       180       190       200
....:....|....:....|....:....|....:....|
                                        
----------------------------------------
fnayyprrvflnnyqaaedhphmvilrllryivrlvwrmh
lhhk fs lskpsd                          
        ie                              
                                        
                                        
                                        
© 1998-2021Legal notice