Dataset for protein Bim of organism Cebus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5Q1U2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1U2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1U2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1U2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1U2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1U2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5Q1U2_BCL2L11      -DRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K5Q1U2_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K5Q1U2_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMVREIEEVVV----------
A0A2K5Q1U2_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMGIFE---------------
A0A2K5Q1U2_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMADWA---------------
A0A2K5Q1U2_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K5Q1U2_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K5Q1U2_BCL2L11      -ASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRLA----------
A0A2K5Q1U2_BCL2L11      -DRSPAPMSCDKSTQTPSPTCQAFNHYLSAMDEATGSSLGIALRREVQWP
A0A2K5Q1U2_BCL2L11      -DRSPAPMSCDKSTQTPSPTCQAFNHYLSAMGDIS---------------
                              . :   . ..    .* :..  . :                   

A0A2K5Q1U2_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5Q1U2_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      AQELRRIGDEFNAYYPRRISLPSD--------------------------
A0A2K5Q1U2_BCL2L11      AQELRRIGDEFNAYYPRRLEK-----------------------------
A0A2K5Q1U2_BCL2L11      -KLLASST------------------------------------------
A0A2K5Q1U2_BCL2L11      VEWLAKSS------------------------------------------
A0A2K5Q1U2_BCL2L11      -LWFSQGTEQLHHKYFS---------------------------------
                                                                          

© 1998-2021Legal notice