Dataset for protein Bim of organism Cebus imitator

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPSD
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRLA
KLLASST
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMDEATGSSLG
IALRREVQWPVEWLAKSS
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=91 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMGDISLWFSQ
GTEQLHHKYFS
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2K5Q1U2_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Cebus imitator GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMADWA
© 1998-2021Legal notice