Dataset for protein classical BH3-containing proteins of organism Catagonus wagneri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .                                                    
------makqpsdvssecdreggqlqpaerppqlrpgaptslqterq----------------gp---------------
mfqise-----------------partgrpsta--rvsawrvalsllgnpegegdrcpqgspq--lappaspgpfatrsp
   gpdrrqetrqkvhssepvvf--pr tkgsrvvasvrsptwqrs-prqqsqqqqslsthqcqqglratqqq tplpaa
      fmpseqrepeppgmlpclpme pg rpptqrt gafvppqsdealqrlglpalsehhegqr  ppae pl    
       emrapedg al dglaaghd d  fgns pn d  sfgpd c gh    f  l c          a       
        a    c   a  de   ea      ac lk    gcde                                  
                    ca   a          c                                           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------drsp--mscdkstqtpsppcqafnh-----ylsamasmrqsqaepadmrpei-----
lfifvrrssllsrsssgyfsfdt----ap-------------------pqrlf-----------ag--t-a--g-rgeee
ylcaptappavtaallkprwrppspatptlprptgsrpsls agqhle     sgvvsyrlgal--gs-q-pl-vqpp g
     q aa sg   g eaapggpk rqrggpesrp hvmy eevted     estppsppsppr r ssla il     
                            ac aarp  g  l   ted       ppegee plf  f  g    e     
                             a   d                     n d a                    
                                                                                
                                                                                

       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
                 :. :.*.::                                                    
-w-------iaq----eLrrigDefnayy---pRr-------saeahtqmv---------------------------
q-qhraevqarreigaqfqcma dlh-l-kgle--vflnryqeqrr-rpsrwrvlyrlivrllwlprdrgapemepnl
         -evryvrr kals q qr-h   - tmyrvnqea-qcwp--pilrywnyfmgsvprmqlgrwnsarsr 
         p eltaik      k  gsf   q qkwcrlir-r--qarr-vwwslpwllqnwqvrn enrllgprq 
             c                  f pgl  cenqfstp-lntqstqvlr chaaadhg aaggg g   
                                        amp hqlnfgqlpp  k   a    aa           
                                         kl gle  ed                           
                                         ak   a  ca                           
© 1998-2022Legal notice