Dataset for protein classical BH3-containing proteins of organism Catagonus wagneri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------makqpsdvssecdreggqlqpaerpp--------------------------qlrpgaptslqterq--pege
mmpqpph---------------------g----gpskpwrtapdllgeaghqqgqpasssrtsarvaptrdrl-gn----
 cfcilergssrrpetrrarqsssrppt-ssaa                          tksrtqlrefpvsvwvpeqvt
       fergeqedmapkphgl sgmlvra                            mhpnqggnr gsdhssysaps
         qd pa     acaa p gard                             gehgdc ka ela pqe   r
                          e  a                               aa   e      lpd    
                          a                                              ff     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------g----p--p---p-p-----p------r-----r--s-------drspa--------p-sc--stqtpspp--a
gdrcpq-spqg-la-pas-g-fatrs-lfifvr-sslls-ss-gyfsfdt-----spsqgvml-m--dk--------cq-
qgtqqrrvsaleqvqtqlrpryssaptippatqcagrgl wtlqerqrprtpr r        acgvttgp pslsgaeq
pqq epqtlde fs slrdcasqqplqalwlataylpsp rpgkpdkgtqsll p         k apre  rrqy nas
e l de le d aq q f a qlc        h cageg pm d aaaspkg  d            gea  mlf    g
c         a          l                  al       fg                             
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
f-----nhylsamasmrqsqaepadmrpeiw---iaqelrrigdefnayyprrr-l------------------------
-lespvpsfp-----------p---------arewgrqfqcmasdls-------qenqyrhapspwrvvyllllrylvlp
hrlplp--a-gwlrggptqae-gvrgeetqq   pwanagaqvaaphqlqellvf-enqqareahpqmqinrimgliprl
y     qr-ttsrpraesrr gqwqhla y    cvlk a g  q afwllg lymvlhnqttnwvwwlv  f hn a h
w     kqsmqg  l   pp  apga   v     dic      k   r k  nniqkffpnscrtlrd           
      hgr m                                          glccce leq    e            
      aa                                              h a a c                   
                                                      a                         

       250 
....:....|.
           
-----------
vdrmqpemepn
rwegangag r
g  nr      
           
           
           
           
© 1998-2023Legal notice