Dataset for protein classical BH3-containing proteins of organism Catagonus wagneri

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A8C3W860_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Catagonus wagneri GN=PMAIP1 (length=55 residues).
MPGRRSRRNTQPNPTRVALPPDPEVECVIQFRRIGDKLNFRQKLLNLIAKFRLET
>gnl|bcl2dbpro|A0A8C3WID6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Catagonus wagneri GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN
>gnl|bcl2dbpro|A0A8C3WID6_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Catagonus wagneri GN=BBC3 (length=204 residues).
GSDRRPETRRKPHASGRLAAAAAAATKSSAAVARTRTRLWFEEQPRQQQQQQQSLQLEQQQQQRPPPQQQPPPQRAALSG
RALLKEAARPPSPSPPACSCPRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN
ALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN
>gnl|bcl2dbpro|A0A8C3WX89_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Catagonus wagneri GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPTGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QVLLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A8C3X5Q0_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Catagonus wagneri GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
ECLAFCT
>gnl|bcl2dbpro|A0A8C3X5Q0_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Catagonus wagneri GN=BCL2L11 (length=180 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRGYCVCENPASCWTRRD
>gnl|bcl2dbpro|A0A8C3X5Q0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Catagonus wagneri GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C3X5Q0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Catagonus wagneri GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMVILRLLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A8C3X5Q0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Catagonus wagneri GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A8C3X9L5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Catagonus wagneri GN=BAD (length=167 residues).
MFQIPEFEQSEQEDSSPADRGLGPGPTGDRPPGPSKPWRTAPDLLGEAGHQQGQPASSSHHGGAGAETRSRHSSYPEGTE
DDEGTEDEELSPFRGRSSSAPPILWAAQRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A8C3XDD1_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Catagonus wagneri GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2022Legal notice