Dataset for protein classical BH3-containing proteins of organism Catagonus wagneri

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3W860_PMAIP1-      -------------------------MPGRRSRRNTQPNPTRVALPPD---
A0A8C3XDD1_HRK-01       -------------------MCPCPLHRGRGPPAVCACSAGRLGLRSS---
A0A8C3WID6_BBC3-01      -------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL----
A0A8C3WX89_BMF-01       --------MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCP
A0A8C3WID6_BBC3-02      ---GSDRRPETRRKPHASGRLAAAAAAATKSSAAVARTRTRLWFEEQPRQ
A0A8C3X9L5_BAD-01       MFQIPEFEQSEQEDSSPADRGLGPGPTGDRPPG--PSKPWRTAPDLLGEA
A0A8C3X5Q0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---
A0A8C3X5Q0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---
A0A8C3X5Q0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNP
A0A8C3X5Q0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNP
A0A8C3X5Q0_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNP
                                                   .                      

A0A8C3W860_PMAIP1-      --------------------------------------------------
A0A8C3XDD1_HRK-01       --------------------------------------------------
A0A8C3WID6_BBC3-01      ------------CEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRW
A0A8C3WX89_BMF-01       LSRLQLFPLTHCCGPGLRPTSQE---------------------------
A0A8C3WID6_BBC3-02      QQQQQQSLQLEQQQQQRPPPQQQPPP---------QRAALSGRALLKEAA
A0A8C3X9L5_BAD-01       GHQQGQPASSSHHGG-----------------------------------
A0A8C3X5Q0_BCL2L11      --------------------------------------------------
A0A8C3X5Q0_BCL2L11      --------------------------------------------------
A0A8C3X5Q0_BCL2L11      EGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFS
A0A8C3X5Q0_BCL2L11      EGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFS
A0A8C3X5Q0_BCL2L11      EGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFS
                                                                          

A0A8C3W860_PMAIP1-      --------------------------------------------------
A0A8C3XDD1_HRK-01       --------------------------------------------------
A0A8C3WID6_BBC3-01      PGGPRSRPRGPRPDGPQPSLSPAEQHLE------SPVPSAPGALAGGPTQ
A0A8C3WX89_BMF-01       ---DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPAGFPTG
A0A8C3WID6_BBC3-02      RPPSPSPPACSCPRGPQPSLSPAEQHLE-----SPVPSAP-GALAGGPTQ
A0A8C3X9L5_BAD-01       ---------AGAETRSRHSSYPEGTEDD-----EGTEDEELSPFRGRSSS
A0A8C3X5Q0_BCL2L11      --------------------------------------ASMRQSQAEPAD
A0A8C3X5Q0_BCL2L11      ---DRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASMRQSQAEPAD
A0A8C3X5Q0_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASMRQSQAEPAD
A0A8C3X5Q0_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASMRQSQAEPAD
A0A8C3X5Q0_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASMRQSQAEPAD
                                                                          

A0A8C3W860_PMAIP1-      -------------------PEVECVIQFRRIGDKLN------FRQKLLNL
A0A8C3XDD1_HRK-01       -------------------AAQLTAARLKALGDELH------QRTMWRRR
A0A8C3WID6_BBC3-01      AAPGVRGEEEQW--------AREIGAQLRRMADDLNALY---ERR----R
A0A8C3WX89_BMF-01       LPLGEQPPEGQWQHRAEVQIAR----KLQCIADQFHRLH-----------
A0A8C3WID6_BBC3-02      AAPGVRGEEEQW-------ARE-IGAQLRRMADDLNALY---ERR----R
A0A8C3X9L5_BAD-01       APPIL------W-------AAQRYGRELRRMSDEFQGSFKGLPRP-----
A0A8C3X5Q0_BCL2L11      MRPEI------W-------IAQ----ELRRIGDEFNAYY---PRR-----
A0A8C3X5Q0_BCL2L11      MRPEI------W-------IAQ----ELRRIGDEFNAYY---PRRVFLNN
A0A8C3X5Q0_BCL2L11      MRPEI------W-------IAQ----ELRRIGDEFNAYY---PRRVFLNN
A0A8C3X5Q0_BCL2L11      MRPEI------W-------IAQ----ELRRIGDEFNAYY---PRRGYCVC
A0A8C3X5Q0_BCL2L11      MRPEI------W-------IAQ----ELRRIGDEFNAYY---PRR-----
                                                   :. :.*.::              

A0A8C3W860_PMAIP1-      IAKFRLET------------------------------
A0A8C3XDD1_HRK-01       ARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A8C3WID6_BBC3-01      QEEQQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN-
A0A8C3WX89_BMF-01       -MQQHQQNQNRVWWQVLLFLHNLALHGDENRNGAGPR-
A0A8C3WID6_BBC3-02      QEEQQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN-
A0A8C3X9L5_BAD-01       -KSAGTATQMRQSPSWKRFLQSWWDRNLGRGGSAPSQ-
A0A8C3X5Q0_BCL2L11      --LAECLAFCT---------------------------
A0A8C3X5Q0_BCL2L11      YQAAEAHPQMVILRLLRYIVRLVWRMQ-----------
A0A8C3X5Q0_BCL2L11      YQAAEAHPQMVILRLLRYIVRLVWRMQ-----------
A0A8C3X5Q0_BCL2L11      ENPASCWTRRD---------------------------
A0A8C3X5Q0_BCL2L11      --------LEQ---------------------------
                                                              

© 1998-2022Legal notice