Dataset for protein classical BH3-containing proteins of organism Catagonus wagneri

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3W860_PMAIP1-      --------------------------MPGRR-------------------
A0A8C3WID6_BBC3-01      ---------------MARARQEGSSPEPVE--------------------
A0A8C3WX89_BMF-01       --------------------------------------------------
A0A8C3WID6_BBC3-02      --------GSDRRPETRRKPHASGRLAAAAAAA-----------------
A0A8C3X9L5_BAD-01       -MFQIPEFEQSEQEDSSPADRGLGPGPTGDRPPGPSKPWRTAPDLLGEAG
A0A8C3X5Q0_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERPP-----------------
A0A8C3X5Q0_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERPP-----------------
A0A8C3X5Q0_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERPP-----------------
A0A8C3X5Q0_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERPP-----------------
A0A8C3X5Q0_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERPP-----------------
A0A8C3XDD1_HRK-01       MCPCPLHRGRGPPAV---CACSAGRLGLRSSAA-----------------
                                                                          

A0A8C3W860_PMAIP1-      ---------SRRNTQPNPTRVALPPDPEVE--------------------
A0A8C3WID6_BBC3-01      ---------GLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPA
A0A8C3WX89_BMF-01       ---------MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDC
A0A8C3WID6_BBC3-02      ---------TKSSAAVARTRTRLWFEEQPRQQQQQQQSLQLEQQQQQRPP
A0A8C3X9L5_BAD-01       HQQGQPASSSHHGGAGAETRSRHSSYPEGTED--DEGTEDEELSP--FRG
A0A8C3X5Q0_BCL2L11      ---------QLRPGAPTSLQTERQ--------------------------
A0A8C3X5Q0_BCL2L11      ---------QLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPG
A0A8C3X5Q0_BCL2L11      ---------QLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPG
A0A8C3X5Q0_BCL2L11      ---------QLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPG
A0A8C3X5Q0_BCL2L11      ---------QLRPGAPTSLQTER---------------------------
A0A8C3XDD1_HRK-01       ---------QLTAARLKALGDEL---------------------------
                                                                          

A0A8C3W860_PMAIP1-      --------------------------------------------------
A0A8C3WID6_BBC3-01      AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPD--------------G
A0A8C3WX89_BMF-01       PL-SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEE
A0A8C3WID6_BBC3-02      PQQQPPP-----QRAALSGRALLKEAARPPSPSPP--------ACSCPRG
A0A8C3X9L5_BAD-01       RSSSAPPILWAAQRYGRELRRMSDEFQGSFKGLPR--------PKSAGTA
A0A8C3X5Q0_BCL2L11      ------------------------------DRSPA--------PMSCDKS
A0A8C3X5Q0_BCL2L11      PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA--------PMSCDKS
A0A8C3X5Q0_BCL2L11      PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA--------PMSCDKS
A0A8C3X5Q0_BCL2L11      PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA--------PMSCDKS
A0A8C3X5Q0_BCL2L11      --------------------------------------------------
A0A8C3XDD1_HRK-01       --------------------------------------------------
                                                                          

A0A8C3W860_PMAIP1-      --------------------------------------------CVIQFR
A0A8C3WID6_BBC3-01      PQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
A0A8C3WX89_BMF-01       PQRLFYGNAGYRLPLPAGFPTGLPLGEQPPEGQWQHRAEVQ---IARKLQ
A0A8C3WID6_BBC3-02      PQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
A0A8C3X9L5_BAD-01       TQMRQSP--SW-----KRFLQS------------------W---WDRNLG
A0A8C3X5Q0_BCL2L11      TQTPSPPCQAF-----NHYLSAMASMRQSQAEPADMRPEIW---IAQELR
A0A8C3X5Q0_BCL2L11      TQTPSPPCQAF-----NHYLSAMASMRQSQAEPADMRPEIW---IAQELR
A0A8C3X5Q0_BCL2L11      TQTPSPPCQAF-----NHYLSAMASMRQSQAEPADMRPEIW---IAQELR
A0A8C3X5Q0_BCL2L11      TQTPSPPCQAF-----NHYLSAMASMRQSQAEPADMRPEIW---IAQELR
A0A8C3X5Q0_BCL2L11      ----------------QASM------RQSQAEPADMRPEIW---IAQELR
A0A8C3XDD1_HRK-01       ----------------HQRTMWRRRARSRRAPAPGALPTYW---PWLCAA
                                                                          

A0A8C3W860_PMAIP1-      RIGDKLNFRQKLLNLIAKFRLET---------------------------
A0A8C3WID6_BBC3-01      RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEP
A0A8C3WX89_BMF-01       CIADQFH-----RLHMQQHQQNQNRVWWQVLLFLHNLALHGDENRNGAGP
A0A8C3WID6_BBC3-02      RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEP
A0A8C3X9L5_BAD-01       RGGSAPSQ------------------------------------------
A0A8C3X5Q0_BCL2L11      RIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIVRLVWRMQ-----
A0A8C3X5Q0_BCL2L11      RIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIVRLVWRMQ-----
A0A8C3X5Q0_BCL2L11      RIGDEFNAYYPRRGYCVCENPASCWTRRD---------------------
A0A8C3X5Q0_BCL2L11      RIGDEFNAYYPRR-------------LEQ---------------------
A0A8C3X5Q0_BCL2L11      RIGDEFNAYYPRRLAECLAFCT----------------------------
A0A8C3XDD1_HRK-01       AQVAALAAWLLGRRNL----------------------------------
                                                                          

A0A8C3W860_PMAIP1-      -
A0A8C3WID6_BBC3-01      N
A0A8C3WX89_BMF-01       R
A0A8C3WID6_BBC3-02      N
A0A8C3X9L5_BAD-01       -
A0A8C3X5Q0_BCL2L11      -
A0A8C3X5Q0_BCL2L11      -
A0A8C3X5Q0_BCL2L11      -
A0A8C3X5Q0_BCL2L11      -
A0A8C3X5Q0_BCL2L11      -
A0A8C3XDD1_HRK-01       -
                         

© 1998-2023Legal notice