Dataset for protein Puma of organism Catagonus wagneri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                           ..**: .. :.::   .:  ** * ..          
gsdrrpetrrkphasgrlaaaaaaatkssaavartrtrlwfeaqa  egqqpeplegeaqdgp  f lqqlvpsavscgl

        90       100       110       120       130       140       150       160
  *   ** :. :**  *   ...:*** :.                   * ****************************
ce glp  laapa  ka alcappa   csaalggprwpggprsrprgpr d                            

       170       180       190       200       210       220       230    
© 1998-2023Legal notice