Dataset for protein Puma of organism Catagonus wagneri

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3WID6_BBC3-01      -----------------------------------------MARARQEGS
A0A8C3WID6_BBC3-02      GSDRRPETRRKPHASGRLAAAAAAATKSSAAVARTRTRLWFEEQPRQQQQ
                                                                   ..**: .

A0A8C3WID6_BBC3-01      SPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYL
A0A8C3WID6_BBC3-02      QQQSLQLEQQQQQRPPPQQQ-----------PPPQRAALSGRALLKEAAR
                        . :.::   .:  ** * ..            *   ** :. :**  *  

A0A8C3WID6_BBC3-01      CAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVP
A0A8C3WID6_BBC3-02      PPSPSPPACSC-------------------PRGPQPSLSPAEQHLESPVP
                         ...:*** :.                   * ******************

A0A8C3WID6_BBC3-01      SAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEE
A0A8C3WID6_BBC3-02      SAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEE
                        **************************************************

A0A8C3WID6_BBC3-01      QQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN
A0A8C3WID6_BBC3-02      QQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN
                        **********************************

© 1998-2022Legal notice