Dataset for protein Puma of organism Catagonus wagneri

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3WID6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Catagonus wagneri GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN
>gnl|bcl2dbpro|A0A8C3WID6_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Catagonus wagneri GN=BBC3 (length=204 residues).
GSDRRPETRRKPHASGRLAAAAAAATKSSAAVARTRTRLWFEEQPRQQQQQQQSLQLEQQQQQRPPPQQQPPPQRAALSG
RALLKEAARPPSPSPPACSCPRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLN
ALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRDRGAPEMEPN
© 1998-2022Legal notice