Dataset for protein classical BH3-containing proteins of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------l-ppecve-l-----
mklsvgaaracscqvprvaslgwfppsqvwslarpprvlvtpdsgpvmakqpsdassemdrerge-ss-q---q-rpgvp
                   qc fahalfsslg kcaqsg clap aeswnlsqepgtlcasagqqgq-a-rppgqeddaf
                                               prhhd a e apwihs   emskpl emwevtw
                                                             fp   n   k  r canpv
                                                                             ccl
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-ardgppptqp-----------------g-l----------------------l------------p-------------
tslqterafplrgsprseghrgthgspq-r-vssalscgpcesqlpappgrpq-fpltylcgptlr-tvtaalggprwpg
q-essrkg---ecgfaga d cpgd    pvlpadvpvslaqpgtdcalaalarlsaalcyasgapfa            
rrpr ghcvvs                    e pts   frpfmsrsr itrv rislhsrsqspy s            
hgmp    rna                    a h      g ea e   fifd   e    e lgg p            
e gl    kl                                                                      
  a     ik                                                                      
        gc                                                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------drspaslspaqqtq---lpcgvts-p--l--g----------sypaglasgrqseeeqwprr-------
gprsrprgsqp-kptqtm-ldsss-tvsprsqdpnv-er-ay-nlgyrlplpa--ltaavpperpqvgpldmesrsrsqp
        presgaqpr-tc-kphagpmtelpafletqacfgevadllhemrtmfrsqsrlmvtgppremah-gprlaal
        fsan----pse-s---gatlrair-senqps  a t a iac eghwqrrmdedspva pdsr-y       
        cdtgptrr-a aevlc drek a  k m  g               n mk   a i d ma el        
        a    lgl     aga  l      h h                  k l      g       f        
             c                   e                                              
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :      .                                                    
-------------------qlrriadelnaqyer--------------qqhrps-w--------ryii-vllwllpl---
peiwiaqraltyswtgvgaevanmgrdftgyfplrvflnnyqrrqeqr-m---rp-vfpdqvcrwvlysrivhrmh-prg
vnvqmhsl   wpqlcirvvi clshwvlrrwkq    prpkgvedhqr-vil-ll        -q-lnlfmgn-a nk 
 gmaa r        ayerk  aklaqihilrvn        shvtep lrtd a         t- - -----r- g  
  l             ecg    fi k dhsqng        magqsw  pqs t         qr p qswnvit    
                aa        g ad hh         l   at      s         ln   k fad n    
                          c                                      l         l    
                                                                                

         
....:....
         
---------
pgrpgmgpr
enadeaeln
  ilhlv q
         
         
         
         
© 1998-2023Legal notice