Dataset for protein classical BH3-containing proteins of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                          **.  .:.**    **      
mklsvgaaracscqvprvascgwahalfvwslarcaqsgvcpasgpvsrnlsqapgsa  kapqda  ecdr  lardgp

        90       100       110       120       130       140       150       160
     *.* *              *  .* * *.*  .  * **                                    
rpfpl q q savscglcepglpa eaa a l a plcap a  -------------------------paspgpfatrs
                                            gnpegspagegdrc hgs q  lap           

       170       180       190       200       210       220       230       240
                        . .*:  ..::  ::* *.        .*:*.   . .  :    * *   *. :*
plfifvrrssllsrsssgyfsfdtdpq almpadkhles s pcpafnhyle l ggpqqaaegmdgee i are aae 

       250       260       270       280       290       
**:.*::** * **      *  ::: .    *:*  :*  :  :            
  ia df  q e  vflnnr eeedhhqmsil l rni mgllplhrgpgapemepn
© 1998-2020Legal notice