Dataset for protein classical BH3-containing proteins of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0WE14_BIK-01       --------------------------------------------------
A0A8C0XK68_BMF-02       --------------------------------------------------
A0A250YBU3_BBC3-01      MKLSVGAARACSCQVPRVASCGWAHALFVWSLARCAQSGVCPASGPVSRN
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A8C0XK68_BMF-01       -------------------QLGFFPPSQSSLGAKPPRVLVTLDPGAEPWH
A0A8C0XEE3_BAD-01       --------------------------------------------------
A0A250YBV9_BCL2L11      -----------------------------------------------MAK
A0A250YBV9_BCL2L11      -----------------------------------------------MAK
A0A8C0VZJ8_HRK-01       --------------------------------------------------
A0A8C0X1Z8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0WE14_BIK-01       -----------------MPKCL--LWENCWESPSGPHCIVP---------
A0A8C0XK68_BMF-02       ----------IFSGELEPPQCVEELEDDVFQAEDGEPGTQP---------
A0A250YBU3_BBC3-01      LSQAPGSAMARARQEGSSPEPVEGL------ARDGPRPFPL---------
A0A250YBU3_BBC3-02      --------MARARQEGSSPEPVEGL------ARDGPRPFPL---------
A0A8C0XK68_BMF-01       HDSEAETLPWSHPGELEPPQCVEELEDDVFQAEDGEPGTQP---------
A0A8C0XEE3_BAD-01       ---------------LNSSQKLPRQRAVTVRGALSGPAKLPRCGFRSAGH
A0A250YBV9_BCL2L11      QPSDASSECDREGGQLQPAERPPQLRPGAPTSLQTEPPGNPEGSPAGEGD
A0A250YBV9_BCL2L11      QPSDASSECDREGGQLQPAERPPQLRPGAPTSLQTEPP------------
A0A8C0VZJ8_HRK-01       ------------------------MCPCPLHRGRGPPAVCA---------
A0A8C0X1Z8_PMAIP1-      --------------------------------MPGRKARKS---------
                                                                          

A0A8C0WE14_BIK-01       --------G-VESHTLPVSPREEMSEARPITRDLFIETLLYEQLPGPP--
A0A8C0XK68_BMF-02       --------GRLLSADL---FAQSQLDCPLGRLQLFPLTHCCGPGLRPT--
A0A250YBU3_BBC3-01      --------GRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVT
A0A250YBU3_BBC3-02      --------GRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVT
A0A8C0XK68_BMF-01       --------GRLLSADL---FAQSQLDCPLGRLQLFPLTHCCGPGLRPT--
A0A8C0XEE3_BAD-01       RGTGD---------------------------------------------
A0A250YBV9_BCL2L11      RCPHGSPQGPLAPPAS---PGPFATRSPLFIFVRRSSLLSRSSSGYFS--
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A8C0VZJ8_HRK-01       --------------------------------------------------
A0A8C0X1Z8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0WE14_BIK-01       --------------------------------------LAAGVSSMTESL
A0A8C0XK68_BMF-02       ------------------SQEDKATQTLSPASPSQGVMLPCGVTEEPQRL
A0A250YBU3_BBC3-01      AALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQH----LESPVPSVPEAL
A0A250YBU3_BBC3-02      AALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQH----LESPVPSVPEAL
A0A8C0XK68_BMF-01       ------------------SQEDKATQTLSPASPSQGVMLPCGVTEEPQRL
A0A8C0XEE3_BAD-01       ---------------------SRCPRSLTLSAGAGATETRSR-HS-----
A0A250YBV9_BCL2L11      ------------------FDTDRSPAPMSCDKSTQTPSPPCQAFN-----
A0A250YBV9_BCL2L11      ---------------------DRSPAPMSCDKSTQTPSPPCQAFN-----
A0A8C0VZJ8_HRK-01       ------------------CSAGRLGLRSSAAQLTAARLKALGDELHQ---
A0A8C0X1Z8_PMAIP1-      ------------------AQANPTRARAELEVQCADLLRRIGDKLNPPGC
                                                                          

A0A8C0WE14_BIK-01       --GTLDLIHCLEGSNQMALRLASIGDEMDLRLRSPRLAQLPGMAMHSLAL
A0A8C0XK68_BMF-02       FYGNAGYRLPLPASFPAGLVLGEQPPEGQWPHR-----------------
A0A250YBU3_BBC3-01      AGG------------PTQAAPGVRGEEEQWARE-----------------
A0A250YBU3_BBC3-02      AGG------------PTQAAPGVRGEEEQWARE-----------------
A0A8C0XK68_BMF-01       FYGNAGYRLPLPASFPAGLVLGEQPPEGQWPHR-------VEVQIAR---
A0A8C0XEE3_BAD-01       -------------SYPAGSDEDEGVEEEPSPFRGRSRSAPPNLWAAQR--
A0A250YBV9_BCL2L11      -------------HYLSAMASMRQSQVEPMDMR-------PEIWIAQ---
A0A250YBV9_BCL2L11      -------------HYLSAMASMRQSQVEPMDMR-------PEIWIAQ---
A0A8C0VZJ8_HRK-01       -----------RTMWRRRARSPRTPAPRALPRY-----------------
A0A8C0X1Z8_PMAIP1-      AAEVLALLAEMPAMKPLKSAPPSPSAPPELE-------------------
                                                                          

A0A8C0WE14_BIK-01       TYSQTGVRGVLRNFIHGLTHLWEN--------MR--SWRLPTPSTWVFPD
A0A8C0XK68_BMF-02       ------VEVQIARKLRCIADQFHR--------LHVQQRQQHRDRAW----
A0A250YBU3_BBC3-01      ------IGAQLRRMADDLNAQYER--------RRQEEQQQHRPSPW----
A0A250YBU3_BBC3-02      ------IGAQLRRMADDLNAQYER--------RRQEEQQQHRPSPW----
A0A8C0XK68_BMF-01       ---------KLRCIADQFHRLHVQ------------QRQQHRDRAW----
A0A8C0XEE3_BAD-01       ------YGRELRRMSDEFDGSFKG---LPRPKSAGTATQMRQSSSW----
A0A250YBV9_BCL2L11      ---------ELRRIGDEFNAYYPRRVFLNNYQGVEDHPQMVILRLL----
A0A250YBV9_BCL2L11      ---------ELRRIGDEFNAYYPRRVFLNNYQGVEDHPQMVILRLL----
A0A8C0VZJ8_HRK-01       -WPWLCAAAQVAALAAWLLGRRNL--------------------------
A0A8C0X1Z8_PMAIP1-      -----AECVQLRRIGDKVNIRQKL--------------------------
                                  :      .                                

A0A8C0WE14_BIK-01       QVCRQLLPSVLLAVLLLG---GILHLVLQ
A0A8C0XK68_BMF-02       ----WQIL-LFLHNLALNRGENRDGAGPR
A0A250YBU3_BBC3-01      ----RVLYNVIMGLLPLPRGPGAPEMEPN
A0A250YBU3_BBC3-02      ----RVLYNVIMGLLPLPRGPGAPEMEPN
A0A8C0XK68_BMF-01       ----WQIL-LFLHNLALNRGENRDGAGPR
A0A8C0XEE3_BAD-01       ----TRII-QSWWDRNLGK----------
A0A250YBV9_BCL2L11      ----RYII-RLVWRMH-------------
A0A250YBV9_BCL2L11      ----RYII-RLVWRMH-------------
A0A8C0VZJ8_HRK-01       -----------------------------
A0A8C0X1Z8_PMAIP1-      ----LNLISKLFNLIT-------------
                                                     

© 1998-2023Legal notice