Dataset for protein classical BH3-containing proteins of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A250YBU3_BBC3-02      --------------------------------------------------
A0A250YBU3_BBC3-01      MKLSVGAARACSCQVPRVASCGWAHALFVWSLARCAQSGVCPASGPVSRN
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
                                                                          

A0A250YBU3_BBC3-02      --------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEP
A0A250YBU3_BBC3-01      LSQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEP
A0A250YBV9_BCL2L11      --------MAKQPSDASSECDREG-----------GQLQP----------
A0A250YBV9_BCL2L11      --------MAKQPSDASSECDREG-----------GQLQP----------
                                **.  .:.**    **           *.* *          

A0A250YBU3_BBC3-02      GLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPD-
A0A250YBU3_BBC3-01      GLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPD-
A0A250YBV9_BCL2L11      ----AERPPQLRPGAPTSLQTEPP--------------------------
A0A250YBV9_BCL2L11      ----AERPPQLRPGAPTSLQTEPPGNPEGSPAGEGDRCPHGSPQGPLAPP
                            *  .* * *.*  .  * **                          

A0A250YBU3_BBC3-02      ----------------------------------GPQPSLSPAQQHLESP
A0A250YBU3_BBC3-01      ----------------------------------GPQPSLSPAQQHLESP
A0A250YBV9_BCL2L11      ----------------------------------DRSPAPMSCDKSTQTP
A0A250YBV9_BCL2L11      ASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
                                                          . .*:  ..::  ::*

A0A250YBU3_BBC3-02      VPSVP------EALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A250YBU3_BBC3-01      VPSVP------EALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A250YBV9_BCL2L11      SPPCQAFNHYLSAMASMRQSQVEPMDMRPEIW---IAQELRRIGDEFNAY
A0A250YBV9_BCL2L11      SPPCQAFNHYLSAMASMRQSQVEPMDMRPEIW---IAQELRRIGDEFNAY
                         *.        .*:*.   . .  :    * *   *. :***:.*::** 

A0A250YBU3_BBC3-02      YERR-----RQEEQQQHRPSPWRVLYNVIMGLLPLPRGPGAPEMEPN
A0A250YBU3_BBC3-01      YERR-----RQEEQQQHRPSPWRVLYNVIMGLLPLPRGPGAPEMEPN
A0A250YBV9_BCL2L11      YPRRVFLNNYQGVEDHPQMVILRLLRYIIRLVWRMH-----------
A0A250YBV9_BCL2L11      YPRRVFLNNYQGVEDHPQMVILRLLRYIIRLVWRMH-----------
                        * **      *  ::: .    *:*  :*  :  :            

© 1998-2020Legal notice