Dataset for protein classical BH3-containing proteins of organism Castor canadensis

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A250YBU3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=251 residues).
MKLSVGAARACSCQVPRVASCGWAHALFVWSLARCAQSGVCPASGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGP
RPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQ
HLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQQHRPSPWRVLYNVIMGLLPLP
RGPGAPEMEPN
>gnl|bcl2dbpro|A0A250YBU3_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QQHRPSPWRVLYNVIMGLLPLPRGPGAPEMEPN
>gnl|bcl2dbpro|A0A250YBV9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Castor canadensis GN=BCL2L11 (length=200 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSLQTEPPGNPEGSPAGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQVEPMDMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQGVEDHPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A250YBV9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Castor canadensis GN=BCL2L11 (length=140 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSLQTEPPDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQVE
PMDMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQGVEDHPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A8C0VZJ8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Castor canadensis GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSPRTPAPRALPRYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C0WE14_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Castor canadensis GN=BIK (length=187 residues).
MPKCLLWENCWESPSGPHCIVPGVESHTLPVSPREEMSEARPITRDLFIETLLYEQLPGPPLAAGVSSMTESLGTLDLIH
CLEGSNQMALRLASIGDEMDLRLRSPRLAQLPGMAMHSLALTYSQTGVRGVLRNFIHGLTHLWENMRSWRLPTPSTWVFP
DQVCRQLLPSVLLAVLLLGGILHLVLQ
>gnl|bcl2dbpro|A0A8C0X1Z8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Castor canadensis GN=PMAIP1 (length=103 residues).
MPGRKARKSAQANPTRARAELEVQCADLLRRIGDKLNPPGCAAEVLALLAEMPAMKPLKSAPPSPSAPPELEAECVQLRR
IGDKVNIRQKLLNLISKLFNLIT
>gnl|bcl2dbpro|A0A8C0XEE3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Castor canadensis GN=BAD (length=149 residues).
LNSSQKLPRQRAVTVRGALSGPAKLPRCGFRSAGHRGTGDSRCPRSLTLSAGAGATETRSRHSSYPAGSDEDEGVEEEPS
PFRGRSRSAPPNLWAAQRYGRELRRMSDEFDGSFKGLPRPKSAGTATQMRQSSSWTRIIQSWWDRNLGK
>gnl|bcl2dbpro|A0A8C0XK68_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Castor canadensis GN=BMF (length=189 residues).
IFSGELEPPQCVEELEDDVFQAEDGEPGTQPGRLLSADLFAQSQLDCPLGRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLVLGEQPPEGQWPHRVEVQIARKLRCIADQFHRLHVQQRQQH
RDRAWWQILLFLHNLALNRGENRDGAGPR
>gnl|bcl2dbpro|A0A8C0XK68_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Castor canadensis GN=BMF (length=230 residues).
QLGFFPPSQSSLGAKPPRVLVTLDPGAEPWHHDSEAETLPWSHPGELEPPQCVEELEDDVFQAEDGEPGTQPGRLLSADL
FAQSQLDCPLGRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGL
VLGEQPPEGQWPHRVEVQIARKLRCIADQFHRLHVQQRQQHRDRAWWQILLFLHNLALNRGENRDGAGPR
© 1998-2023Legal notice