Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------pqecsspldrgvgqpqdgerppqlrrllpt-l--
mgtpenpsaapttrklsirrrrresggrqyrgwrqsmfqipemaqs--qvvee-edelfpspt--------pg---s-gl
                             waapag       femqesdd---c--dg--lepadpgagps--asadv  
                                            kerp--pc ahp-- l--- p  fp tkhwlsap  
                                            ra  mg      vr  arv          v ge   
                                                         e   a                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------q--------------------------------------------------------dr-pgt-s---rsq-p
lgeqtqs-gqplgsplsrpqlfplthlcgpglrptsqersplfifvrrssllsrsssgyfsfdt--s---m-vet---t-
   fghrcepgadcgprclags qgycap tspgpvttalga                      skhtqplapdsstrhv
   aaeq  n epeadaa   l aap  a aa  afaa                          phagaggrcakpgpgs
   scgl      a                                                    w   p srp   r 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      *. :.*.::                 
s-pcg---------es--psr-----gvpasarpgl------waaq------reLrrigDefhaly---pr---vrtqaq
-y---vtnhyqtlm--nr---lplpasrsrgtplniqpsegqvqhraeirig-q qcma qlnvyhkgl--rvsmqqhti
mp aqpfeeplsefygmgqyqpgal afgtdlareerspptrlirep vqyaik kals k  rsfmwrr prfaghaq-
dl qpaeddegraeadlagfa     mpcsrg  sv geae  t d   ec ar      d  qrt   e akq-----p
 g   slspaeqhl  pv        cg  q    a    a  p a                 f q        rerprh
                           a  a                                           e a   

       250       260       270     
....:....|....:....|....:....|....:
                                   
nrqpqwwlrllqlylvr-----llgrgn-------
mgnspsvtlrvlswnsaalaawnvwdrgsnpsqpr
e-hrmm-qifcfrhqlp     fnrsmqragag n
-p---- --n vnliak      p getlpeve  
ras wy pyk iag              a      
g l tr  w  a a                     
© 1998-2020Legal notice