Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgrsagervafrvptpaglhwgrrpglesgarsagsvlspgdrlsgaagawaegsppqcveglerdgfqpedgepgaqpr
 eapenpsa      trk sir  r r   yg                 qrqa as gpt ergdfvwr    qt rram
 at                           g                   ae   a el    a   pa    m  gwgl
 vd                                               t                          g  
 s                                                                              
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rslsadlfaqsqldcplsrrvlqlppvtcacgpgepglrptsqedkatqtlspaapsqpamlpaavraraafggefvnnr
cla      g    q spt  pvdfelehcislcalpv ssa           ssratgvla cgm              
 ps           f  hp  gan  savs  a r                  e  easca  r y              
                 d    rg  av                         v   c  q    f              
                      k                                                         
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------p--------------------------------------------------------------------
lafggleapqi-efatdwlrlrxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
     tleftalfaxxxxxxxxc                                                         
     fcsgar pyv ekrka                                                           
         wv asr                                                                 
            nq                                                                  
            h                                                                   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------ss--dr-gg------rpp-l--
xxxxxxxxxxxxxxxxxxxxxxgnagresralypappscglsggsrkkdqmakqpsdv--ec--e--qlqpae---q-rk
                    gw sse      fev  gi fqsargsprpweqseqed  pa  glppsptgdlfsgps 
                       e d      w     e  meqlca   fp                  grs  rs t 
                                          a                            qq     p 
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----pg---s----e-q---------------------------------------------------------rspap
hwlta--apt-lsqt-r-gqpagsshhggtgavetplappaspgpfatrsplfifvrrssllsrsssgyfsfdtd-----
   psr llge  aghqh n e egdrcpq spqg                                       rhlsy 
    pd pqp   pa                                                           le  v 
    i                                                                         l 
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .*: :.*.::               
a-------------p---------a-as-rqsqa-p---trpeiw---a---iareLrrigDefnayyp----rrvqv--
mspecdkstqtpsp-cqafnhylg-m--mgp---v-adr-pe-q-ahr-qrqygqq qcma qlhvlfmglpr--rfgrr
-g  d eg eeed l        spfrg --trsplgvqa--n- q   ri --ak kals k  rsqk    qq---th
sa                       l   fragla  e pe gl     ee t -r      d  frh-    pksaqna
                                       g          l              q te    w hnee 
                                                                         v lrdv 
                                                                           agrs 
                                                                            ea  
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------p-p--------------vl---------------lsllvrll------------sm
qrmwwqillflhnvalngdenrqe-s-rasttywpwrsntvf-eagvspxxvlrarts-nyia--vgwfpggrggsevr-
tqi                rs nsghwg lprs gqmcaaa-v      srf      yr---ln- r   psaap a-s
nah                   trag         tl    kt      lfl      v-wcskem p      rr dpp
p s                   rg a         pf    q       wn       qdvalggc s          eg
                       t                 e                daf iw   k          ti
                       a                                  r   pq              lt
                                                          p   h                q
                                                          a                    n

 
.
 
q
t
-
n
r
l
f
 
 
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice