Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452EST2_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A452ER54_BAD-02       -----------------------------YRAWAQSMFQIPEFEQSEQED
A0A452E3G1_BBC3-01      ------------------------------------------MARARQEG
A0A452ER54_BAD-01       MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQED
A0A452FCR6_BCL2L11      ------------------------------------------MAKQPSDV
A0A452FCR6_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A452EST2_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       MCPC-----PLHRGRGPPAVCACSAGRLGLRSS-----------------
A0A452ER54_BAD-02       SSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGE-AGHQQGQPAGS-----
A0A452E3G1_BBC3-01      SSP-EPVEGLARDGPRPFPLS------RLVPSAVSCGLCEPGLPAAPAAP
A0A452ER54_BAD-01       SSPADRGLGPSPTGDRPPGLT------PGLLGE-AGHQQGQPAGS-----
A0A452FCR6_BCL2L11      SSECDREGGQLQPAERPPQLR------PGAPTSLQTERQGNPEGEGDRCP
A0A452FCR6_BCL2L11      SSECDREGGQLQPAERPPQLR------PGAPTSLQTERQ-----------
                                                                          

A0A452EST2_PMAIP1-      -------------------------------------------------M
A0A452DXE5_HRK-01       --------------------------------------------------
A0A452ER54_BAD-02       ---------------------------------------------SHHGG
A0A452E3G1_BBC3-01      ALLPAAYLCAPTAPPAVTAALGAPRW-------------------PGGPR
A0A452ER54_BAD-01       ---------------------------------------------SHHGG
A0A452FCR6_BCL2L11      QGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA
A0A452FCR6_BCL2L11      ---------------------------------------------DRSPA
                                                                          

A0A452EST2_PMAIP1-      PGRRARRSAQPSPTRVPADPEVECA-------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A452ER54_BAD-02       TGAVETRSRHSSYPAGPEDDEGTEE--EDLGPFRGRSRSAPPNL------
A0A452E3G1_BBC3-01      SRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQ
A0A452ER54_BAD-01       TGAVETRSRHSSYPAGPEDDEGTEE--EDLGPFRGRSRSAPPNL------
A0A452FCR6_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAM--ASMRQSQAVPADTRPEI------
A0A452FCR6_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAM--ASMRQSQAVPADTRPEI------
                                                                          

A0A452EST2_PMAIP1-      -------IQLRRIGDKLNF----------------------------RQK
A0A452DXE5_HRK-01       -AAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQ
A0A452ER54_BAD-02       WAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSW-----TRF
A0A452E3G1_BBC3-01      WARE-IGAQLRRMADDLNALY---ERRRQEERQRHRPSPWRV-----LYN
A0A452ER54_BAD-01       WAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSW-----TRF
A0A452FCR6_BCL2L11      WIAQ----ELRRIGDEFNAYY---PRRVFVRHQAIEGHPQMV-----LLR
A0A452FCR6_BCL2L11      WIAQ----ELRRIGDEFNAYY---PRRVFVRHQAIEGHPQMV-----LLR
                                 *. :.*.::                                

A0A452EST2_PMAIP1-      LVNLIAKLLRSGT-------
A0A452DXE5_HRK-01       VAALAAWLLGRRNL------
A0A452ER54_BAD-02       LQSWLSRNLGRGGSAPSQ--
A0A452E3G1_BBC3-01      LILGLLPFPGGRGAPEVEPN
A0A452ER54_BAD-01       LQSWLSRNLGRGGSAPSQ--
A0A452FCR6_BCL2L11      VLRYLVRLVWRMQ-------
A0A452FCR6_BCL2L11      VLRYLVRLVWRMQ-------
                        :                   

© 1998-2023Legal notice