Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2P9C6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
A0A8C2R6N9_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A8C2RGP9_BBC3-01      --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A8C2PEE2_BAD-02       --------------------------------------------------
A0A8C2PEE2_BAD-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452F2E0_BMF-01       MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLF
A0A452F2E0_BMF-02       MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLF
A0A8C2SHH9_BMF-01       MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLF
A0A8C2P0X3_BCL2L11      ---------------------------------------MSDPNSRTEKR
A0A8C2P0X3_BCL2L11      -MGASAGERVAFRVPTPAGLHWGRRPG--LESGAGSAGSVLSPGDRLSGA
A0A8C2P0X3_BCL2L11      -MGASAGERVAFRVPTPAGLHWGRRPG--LESGAGSAGSVLSPGDRLSGA
A0A452E3G1_BBC3-01      -MARARQE--------------GSSPE--PVEGLARDGPRPFPLSRLVPS
A0A8C2RGP9_BBC3-02      -MARARQE--------------GSSPE--PVEGLARDGPRPFPLSRLVPS
                                                                          

A0A8C2P9C6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
A0A8C2R6N9_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A8C2RGP9_BBC3-01      --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A8C2PEE2_BAD-02       --------------------------------------------------
A0A8C2PEE2_BAD-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452F2E0_BMF-01       PLTHC--CGPGL--------------------------------------
A0A452F2E0_BMF-02       PLTHC--CGPGL--------------------------------------
A0A8C2SHH9_BMF-01       PLTHC--CGPGL--------------------------------------
A0A8C2P0X3_BCL2L11      KARCE---------------------------------------------
A0A8C2P0X3_BCL2L11      AGAAEAGAAPGLTEGRGRFGWAAPVPEAPETSAAAPAAVRARAAFGGEFV
A0A8C2P0X3_BCL2L11      AGAAEAGAAPGLTEGRGRFGWAAPVPEAPETSAAAPAAVRARAAFGGEFV
A0A452E3G1_BBC3-01      AVSCGL-CEPGL-------------PAAPAAPALLPAAY-----------
A0A8C2RGP9_BBC3-02      AVSCGL-CEPGL-------------PAAPAAPALLPAAY-----------
                                                                          

A0A8C2P9C6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
A0A8C2R6N9_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A8C2RGP9_BBC3-01      --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A8C2PEE2_BAD-02       --------------------------------------------------
A0A8C2PEE2_BAD-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A8C2SHH9_BMF-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      NNRLAFGGLLAGAAPAAATDWLRLRXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2P0X3_BCL2L11      NNRLAFGGLLAGAAPAAATDWLRLRXXXXXXXXXXXXXXXXXXXXXXXXX
A0A452E3G1_BBC3-01      --------LCAPTAPPA---------------------------------
A0A8C2RGP9_BBC3-02      --------LCAPTAPPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                                                                          

A0A8C2P9C6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
A0A8C2R6N9_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A8C2RGP9_BBC3-01      --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
A0A452ER54_BAD-01       -----------------------------------------MGTPENPSA
A0A8C2PEE2_BAD-02       --------------------------------------------------
A0A8C2PEE2_BAD-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A8C2SHH9_BMF-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2P0X3_BCL2L11      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A452E3G1_BBC3-01      ----------------------------------------------VTAA
A0A8C2RGP9_BBC3-02      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
                                                                          

A0A8C2P9C6_PMAIP1-      ------------------------------------------RRARRSAQ
A0A452EST2_PMAIP1-      ---------------------------------------MPGRRARRSAQ
A0A8C2R6N9_PMAIP1-      ---------------------------------------QTGGWGLCSSQ
A0A452DXE5_HRK-01       ---------------------------------------MCPCPLHRGRG
A0A8C2RGP9_BBC3-01      ---------------------VRATAEVARACPCQLPRAFFSPWVPHQIR
A0A452ER54_BAD-02       --------------------YRAWAQSMFQIPEFEQSEQEDSSPADRGLG
A0A452ER54_BAD-01       APTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQEDSSPADRGLG
A0A8C2PEE2_BAD-02       ---------------------------MFQIPEFEQSEQEDSSPADRGLG
A0A8C2PEE2_BAD-01       ---------------------------MFQIPEFEQSEQEDSSPADRGLG
A0A8C2P0X3_BCL2L11      ---------------------------------MAKQPSDVSSECDREGG
A0A452FCR6_BCL2L11      ---------------------------------MAKQPSDVSSECDREGG
A0A452FCR6_BCL2L11      ---------------------------------MAKQPSDVSSECDREGG
A0A8C2P0X3_BCL2L11      ---------------------------------MAKQPSDVSSECDREGG
A0A452F2E0_BMF-01       ---------------------------------------RPTSQEDKATQ
A0A452F2E0_BMF-02       ---------------------------------------RPTSQEDKATQ
A0A8C2SHH9_BMF-01       ---------------------------------------RPTSQEDKATQ
A0A8C2P0X3_BCL2L11      ----------------------GFMEQRRKKDQMAKQPSDVSSECDREGG
A0A8C2P0X3_BCL2L11      XXXXXGSSERESRALFPAPPSCGLSGGSRKKDQMAKQPSDVSSECDREGG
A0A8C2P0X3_BCL2L11      XXXXXGSSERESRALFPAPPSCGLSGGSRKKDQMAKQPSDVSSECDREGG
A0A452E3G1_BBC3-01      L----------GAPRW---PG-GPRSRPRGPRP---------------DG
A0A8C2RGP9_BBC3-02      W----------GEADWEVPPGIGLQSASCSPRPFPGPGQQLFSSPPPSPG
                                                                          

A0A8C2P9C6_PMAIP1-      P-SPTRVPADPE--------------------------------------
A0A452EST2_PMAIP1-      P-SPTRVPADPE--------------------------------------
A0A8C2R6N9_PMAIP1-      PLDPLK---NPE--------------------------------------
A0A452DXE5_HRK-01       PPAVCACSAGRL--------------------------------------
A0A8C2RGP9_BBC3-01      GPQPSLSPAEQHLESPVPSAPGAL--------------------------
A0A452ER54_BAD-02       PSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS---------------
A0A452ER54_BAD-01       PSPTGDRPPGLT------PGLLGEAGHQQGQPAGS---------------
A0A8C2PEE2_BAD-02       PSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS---------------
A0A8C2PEE2_BAD-01       PSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS---------------
A0A8C2P0X3_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQ---------------------
A0A452FCR6_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQ---------------------
A0A452FCR6_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAP
A0A8C2P0X3_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAP
A0A452F2E0_BMF-01       TLSPASPSQGVMLPCGVTEEPQRLFYGNA---------------------
A0A452F2E0_BMF-02       TLSPASPSQGVMLPCGVTEEPQRLFYGNA---------------------
A0A8C2SHH9_BMF-01       TLSPASPSQGVMLPCGVTEEPQRLFYGNA---------------------
A0A8C2P0X3_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAP
A0A8C2P0X3_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQ---------------------
A0A8C2P0X3_BCL2L11      QLQPAERPPQLR-----PGAPTSLQTERQ---------------------
A0A452E3G1_BBC3-01      P-QPSLSPAEQHLESPVPSAPGAL--------------------------
A0A8C2RGP9_BBC3-02      P-QPSLSPAEQHLESPVPSAPGAL--------------------------
                                                                          

A0A8C2P9C6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
A0A8C2R6N9_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A8C2RGP9_BBC3-01      --------------------------------------------------
A0A452ER54_BAD-02       -----------------------------------SHHGGTGAVETRSRH
A0A452ER54_BAD-01       -----------------------------------SHHGGTGAVETRSRH
A0A8C2PEE2_BAD-02       -----------------------------------SHHGGTGAVETRSRH
A0A8C2PEE2_BAD-01       -----------------------------------SHHGGTGAVETRSRH
A0A8C2P0X3_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A452FCR6_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A452FCR6_BCL2L11      PASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A8C2P0X3_BCL2L11      PASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A8C2SHH9_BMF-01       --------------------------------------------------
A0A8C2P0X3_BCL2L11      PASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A8C2P0X3_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A8C2RGP9_BBC3-02      --------------------------------------------------
                                                                          

A0A8C2P9C6_PMAIP1-      --------------------------------------VECAIQLRRIGD
A0A452EST2_PMAIP1-      --------------------------------------VECAIQLRRIGD
A0A8C2R6N9_PMAIP1-      --------------------------------------VECAIQLRRIGD
A0A452DXE5_HRK-01       ------------------------GLRSSAAQL-------TAARLKALGD
A0A8C2RGP9_BBC3-01      ---------------AGGPTQAAPGVRGEEEQW----AREIGAQLRRMAD
A0A452ER54_BAD-02       SSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLW---AAQRYGRELRRMSD
A0A452ER54_BAD-01       SSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLW---AAQRYGRELRRMSD
A0A8C2PEE2_BAD-02       SSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLW---AAQRYGRELRRMSD
A0A8C2PEE2_BAD-01       SSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLW---AAQRYGRELRRMSD
A0A8C2P0X3_BCL2L11      PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A452FCR6_BCL2L11      PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A452FCR6_BCL2L11      PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A8C2P0X3_BCL2L11      PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A452F2E0_BMF-01       --------GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIAD
A0A452F2E0_BMF-02       --------GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIAD
A0A8C2SHH9_BMF-01       --------GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIAD
A0A8C2P0X3_BCL2L11      PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A8C2P0X3_BCL2L11      PSPPCQAFNHYLSAMASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A8C2P0X3_BCL2L11      ---------------ASMRQSQAVPADTRPEIW-------IAQELRRIGD
A0A452E3G1_BBC3-01      ---------------AGGPTQAAPGVRGEEEQWAR----EIGAQLRRMAD
A0A8C2RGP9_BBC3-02      ---------------AGGPTQAAPGVRGEEEQWAR----EIGAQLRRMAD
                                                                 .  *. :.*

A0A8C2P9C6_PMAIP1-      KLNFRQK------------------------LVNLIAKLLRSGT------
A0A452EST2_PMAIP1-      KLNFRQK------------------------LVNLIAKLLRSGT------
A0A8C2R6N9_PMAIP1-      KLNFRQK------------------------LVNLIAKLLRSGT------
A0A452DXE5_HRK-01       ELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL-
A0A8C2RGP9_BBC3-01      DLNALYERRRQEERQRHRPSPWRVLYN------LILGLLPFPGGRGAPEV
A0A452ER54_BAD-02       EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ--
A0A452ER54_BAD-01       EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ--
A0A8C2PEE2_BAD-02       EFHVSFK----VRAGGSAPQSRTTPG------PVLPDLLPLGCPSARRDL
A0A8C2PEE2_BAD-01       EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ--
A0A8C2P0X3_BCL2L11      EFNAYYPRRLER--------------------------------------
A0A452FCR6_BCL2L11      EFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ----------
A0A452FCR6_BCL2L11      EFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ----------
A0A8C2P0X3_BCL2L11      EFNAYYPRRVFVRHQAIEGHPQMVLXXVLRYLVRLVWRMQ----------
A0A452F2E0_BMF-01       QFHRLHMQQHQQNRNRM-----------WWQILLFLHNVALNGDENRNGA
A0A452F2E0_BMF-02       QFHRLHMQQHQQNRNRM-----------WWQILLFLHNVALNGDENRNGA
A0A8C2SHH9_BMF-01       QFHRLHMQQHQQNRNRM-----------WWQILLFLHNVALNGDENRNGA
A0A8C2P0X3_BCL2L11      EFNAYYPRRVFVRHQAIEGHPQMVLXXVLRYLVRLVWRMQ----------
A0A8C2P0X3_BCL2L11      EFNAYYPRRVND-----------VFFTSFFDSVLILEMSSIT--------
A0A8C2P0X3_BCL2L11      EFNAYYPRRVND-----------VFFTSFFDSVLILEMSSIT--------
A0A452E3G1_BBC3-01      DLNALYERRRQEERQRHRPSPWRVLYN------LILGLLPFPGGRGAPEV
A0A8C2RGP9_BBC3-02      DLNALYERRRQEERQRHRPSPWRVLYN------LILGLLPFPGGRGAPEV
                        .::                                               

A0A8C2P9C6_PMAIP1-      ---------------------------------------------
A0A452EST2_PMAIP1-      ---------------------------------------------
A0A8C2R6N9_PMAIP1-      ---------------------------------------------
A0A452DXE5_HRK-01       ---------------------------------------------
A0A8C2RGP9_BBC3-01      EPN------------------------------------------
A0A452ER54_BAD-02       ---------------------------------------------
A0A452ER54_BAD-01       ---------------------------------------------
A0A8C2PEE2_BAD-02       QF-------------------------------------------
A0A8C2PEE2_BAD-01       ---------------------------------------------
A0A8C2P0X3_BCL2L11      ---------------------------------------------
A0A452FCR6_BCL2L11      ---------------------------------------------
A0A452FCR6_BCL2L11      ---------------------------------------------
A0A8C2P0X3_BCL2L11      ---------------------------------------------
A0A452F2E0_BMF-01       GPR------------------------------------------
A0A452F2E0_BMF-02       GPR------------------------------------------
A0A8C2SHH9_BMF-01       GPRASTRSWGPLSNTVEVEAGVSPWNLLRARTSRSFCHQLLKTTR
A0A8C2P0X3_BCL2L11      ---------------------------------------------
A0A8C2P0X3_BCL2L11      ---------------------------------------------
A0A8C2P0X3_BCL2L11      ---------------------------------------------
A0A452E3G1_BBC3-01      EPN------------------------------------------
A0A8C2RGP9_BBC3-02      EPN------------------------------------------
                                                                     

© 1998-2022Legal notice