Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452EST2_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       ------------------------------------------------MC
A0A452ER54_BAD-02       -----------------------------YRAWAQSMFQIPEFEQSEQED
A0A452F2E0_BMF-01       --------------------------------------------MEPPQC
A0A452F2E0_BMF-02       --------------------------------------------MEPPQC
A0A452E3G1_BBC3-01      ------------------------------------------MARARQEG
A0A452ER54_BAD-01       MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQED
A0A452FCR6_BCL2L11      ------------------------------------------MAKQPSDV
A0A452FCR6_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A452EST2_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       PCPLHRGRGPPAV-------------------------------------
A0A452ER54_BAD-02       SSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS------
A0A452F2E0_BMF-01       VEELEDDVFQPEDGEPGAQPRRLLSADL-----FAQSQ---LDCPLSRLQ
A0A452F2E0_BMF-02       VEELEDDVFQPEDGEPGAQPRRLLSADL-----FAQSQ---LDCPLSRLQ
A0A452E3G1_BBC3-01      SSP-EPVEGLARDGPRPFPLSRLVPSAV-----SCGLCEPGLPAAPAAPA
A0A452ER54_BAD-01       SSPADRGLGPSPTGDRPPGLTPGLLGE------AGHQQGQPAGS------
A0A452FCR6_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSL-----QTERQ------------
A0A452FCR6_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSL-----QTERQGNPEGEGDRCPQ
                                                                          

A0A452EST2_PMAIP1-      --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------SHHGGT
A0A452F2E0_BMF-01       LFPLTHCCGPGLRPTSQE--------------------------DKATQT
A0A452F2E0_BMF-02       LFPLTHCCGPGLRPTSQE--------------------------DKATQT
A0A452E3G1_BBC3-01      LLPAAYLCAPTAPPAVTAALGA----------------------PRWPGG
A0A452ER54_BAD-01       --------------------------------------------SHHGGT
A0A452FCR6_BCL2L11      --------------------------------------------DRSPAP
A0A452FCR6_BCL2L11      GSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAP
                                                                          

A0A452EST2_PMAIP1-      ------------------------------------MPGRRARRSAQPSP
A0A452DXE5_HRK-01       ------------------------------------CACSAGRLGLRSSA
A0A452ER54_BAD-02       GAVETRSRHSSYPAGPEDDEGTEEEDLGPFR-----GRSRSAPPNL----
A0A452F2E0_BMF-01       LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPE
A0A452F2E0_BMF-02       LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPE
A0A452E3G1_BBC3-01      PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEE
A0A452ER54_BAD-01       GAVETRSRHSSYPAGPEDDEGTEEEDLGPFR-----GRSRSAPPNL----
A0A452FCR6_BCL2L11      MSCDKSTQTPSPPCQAFNHYLSAMASMRQSQ-----AVPADTRPEI----
A0A452FCR6_BCL2L11      MSCDKSTQTPSPPCQAFNHYLSAMASMRQSQ-----AVPADTRPEI----
                                                                          

A0A452EST2_PMAIP1-      TRVPADPEVECAIQLRRIGDKLNFRQ-----------------------K
A0A452DXE5_HRK-01       AQLTAA-------RLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWL
A0A452ER54_BAD-02       --WAAQ---RYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRF
A0A452F2E0_BMF-01       GQWQHRAEIQIARKLQCIADQFHRLH--------MQQHQQNRNRMWWQIL
A0A452F2E0_BMF-02       GQWQHRAEIQIARKLQCIADQFHRLH--------MQQHQQNRNRMWWQIL
A0A452E3G1_BBC3-01      EQWARE----IGAQLRRMADDLNALY---ERRRQEERQRHRPSPWRVLYN
A0A452ER54_BAD-01       --WAAQ---RYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRF
A0A452FCR6_BCL2L11      --WIAQ-------ELRRIGDEFNAYY---PRRVFVRHQAIEGHPQMVLLR
A0A452FCR6_BCL2L11      --WIAQ-------ELRRIGDEFNAYY---PRRVFVRHQAIEGHPQMVLLR
                                      *. :.*.::                           

A0A452EST2_PMAIP1-      LVNLIAK-----LLRSGT-------
A0A452DXE5_HRK-01       CAAAQVAALAAWLLGRRNL------
A0A452ER54_BAD-02       LQSWLSR-----NLGRGGSAPSQ--
A0A452F2E0_BMF-01       LFLHNVA-----LNGDENRNGAGPR
A0A452F2E0_BMF-02       LFLHNVA-----LNGDENRNGAGPR
A0A452E3G1_BBC3-01      LILGLLP-----FPGGRGAPEVEPN
A0A452ER54_BAD-01       LQSWLSR-----NLGRGGSAPSQ--
A0A452FCR6_BCL2L11      VLRYLVR-----LVWRMQ-------
A0A452FCR6_BCL2L11      VLRYLVR-----LVWRMQ-------
                                                 

© 1998-2020Legal notice