Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

21 sequence(s)

>gnl|bcl2dbpro|A0A452DXE5_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Capra hircus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A452E3G1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Capra hircus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A452ER54_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=198 residues).
MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLTPGLLGEAGH
QQGQPAGSSHHGGTGAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLP
RPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A452ER54_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=175 residues).
YRAWAQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRH
SSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQS
WLSRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A452EST2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Capra hircus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|A0A452F2E0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A452F2E0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A452FCR6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A452FCR6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A8C2P0X3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=360 residues).
MGASAGERVAFRVPTPAGLHWGRRPGLESGAGSAGSVLSPGDRLSGAAGAAEAGAAPGLTEGRGRFGWAAPVPEAPETSA
AAPAAVRARAAFGGEFVNNRLAFGGLLAGAAPAAATDWLRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSERESRALFPAPPSCGLSGGSRKKDQMAKQPSDVSS
ECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWI
AQELRRIGDEFNAYYPRRVNDVFFTSFFDSVLILEMSSIT
>gnl|bcl2dbpro|A0A8C2P0X3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAIEGHPQMVLXXVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A8C2P0X3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=222 residues).
MSDPNSRTEKRKARCEGFMEQRRKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQ
GSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQS
QAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAIEGHPQMVLXXVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A8C2P0X3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=111 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRLER
>gnl|bcl2dbpro|A0A8C2P0X3_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=330 residues).
MGASAGERVAFRVPTPAGLHWGRRPGLESGAGSAGSVLSPGDRLSGAAGAAEAGAAPGLTEGRGRFGWAAPVPEAPETSA
AAPAAVRARAAFGGEFVNNRLAFGGLLAGAAPAAATDWLRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSERESRALFPAPPSCGLSGGSRKKDQMAKQPSDVSS
ECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVNDVFFTSFFDS
VLILEMSSIT
>gnl|bcl2dbpro|A0A8C2P9C6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Capra hircus GN=PMAIP1 (length=51 residues).
RRARRSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|A0A8C2PEE2_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=162 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYPAGP
EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKVRAGGSAPQSRTTPGPVLPDLLPLGCPSARRDL
QF
>gnl|bcl2dbpro|A0A8C2PEE2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYPAGP
EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
>gnl|bcl2dbpro|A0A8C2R6N9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Capra hircus GN=PMAIP1 (length=52 residues).
QTGGWGLCSSQPLDPLKNPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|A0A8C2RGP9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Capra hircus GN=BBC3 (length=291 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGWGEADWEVPP
GIGLQSASCSPRPFPGPGQQLFSSPPPSPGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A8C2RGP9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Capra hircus GN=BBC3 (length=131 residues).
VRATAEVARACPCQLPRAFFSPWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A8C2SHH9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=226 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPRASTRSWGPLSNTVEVEAGVSPWNLLRARTSRSFCHQLLKTTR
© 1998-2022Legal notice