Dataset for protein Bad of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    **********************************:      ***
------------------------------------MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLskhwltaPGL
mgtpenpsaapttrklsirrrrresggrqyrgwrqs                                  t------   
                             waapag                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHV
                                                                                
                                                                                

       170       180       190       200        
....:....|....:....|....:....|....:....|....:...
***     .:.*:*.* * :*.      . *.  *  * .:. .    
SFKglprpksaGtAtQmRqsPswtrflqswLsrnLgrGgsapsq----
   ----vrag s p s tt g------pv pdl pl cpsarrdlqf
                                                
© 1998-2022Legal notice