Dataset for protein Bad of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452ER54_BAD-02      -----------------------------YRAWAQSMFQIPEFEQSEQED
A0A452ER54_BAD-01      MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQED
A0A8C2PEE2_BAD-02      ------------------------------------MFQIPEFEQSEQED
A0A8C2PEE2_BAD-01      ------------------------------------MFQIPEFEQSEQED
                                                           **************

A0A452ER54_BAD-02      SSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGT
A0A452ER54_BAD-01      SSPADRGLGPSPTGDRPPGLT------PGLLGEAGHQQGQPAGSSHHGGT
A0A8C2PEE2_BAD-02      SSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGT
A0A8C2PEE2_BAD-01      SSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGT
                       ********************:      ***********************

A0A452ER54_BAD-02      GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRE
A0A452ER54_BAD-01      GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRE
A0A8C2PEE2_BAD-02      GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRE
A0A8C2PEE2_BAD-01      GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRE
                       **************************************************

A0A452ER54_BAD-02      LRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGS
A0A452ER54_BAD-01      LRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGS
A0A8C2PEE2_BAD-02      LRRMSDEFHVSFK----VRAGGSAPQSRTTPG------PVLPDLLPLGCP
A0A8C2PEE2_BAD-01      LRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGS
                       *************     .:.*:*.* * :*.      . *.  *  * .

A0A452ER54_BAD-02      APSQ----
A0A452ER54_BAD-01      APSQ----
A0A8C2PEE2_BAD-02      SARRDLQF
A0A8C2PEE2_BAD-01      APSQ----
                       :. .    

© 1998-2022Legal notice