Dataset for protein Bad of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A452ER54_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=198 residues).
MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLTPGLLGEAGH
QQGQPAGSSHHGGTGAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLP
RPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A452ER54_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=175 residues).
YRAWAQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRH
SSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQS
WLSRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A8C2PEE2_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=162 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYPAGP
EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKVRAGGSAPQSRTTPGPVLPDLLPLGCPSARRDL
QF
>gnl|bcl2dbpro|A0A8C2PEE2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Capra hircus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYPAGP
EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
© 1998-2022Legal notice