Dataset for protein Noxa of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ascspiphlllqkhlklsctvtcplavslssvqrwsdshlcrgkalhavlsgagnepsplprpyththththshthtshl

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
psqtavcwpapgfqcgtfvtcpwhplycygrflhfkprshpfppspallccslsgtcpgsliagydkdpapcphlhrlpa

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rracpargfptppppqlsrgggggwaggaprrdppppgsrpagegrgcgaggstgpgrsprsdlgggagagagagaepgf

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aasrspgppykrraparerakraasgerraasgerraasgerraasgerraasgaaprvlpavpvlvpsrpcwsrgarag

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       *** ***:.***  **::*..** * * *:   :. .:*::
--------------------------------------pGRKkRKStrPGPtrAPkqLsvECeItLrKyhpklttrqKml
peppvlvprcpcwsraaragpqaqgvvrcssprppaemk   a   aq   gg  ee ef  a q e fgdfinfkk li

       410 
....:....|.
*:**:::*.*.
NmLSqvlRsGt
 l  klf n k
© 1998-2023Legal notice