Dataset for protein Noxa of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0N2L6_PMAIP1-      ASCSPIPHLLLQKHLKLSCTVTCPLAVSLSSVQRWSDSHLCRGKALHAVL
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      SGAGNEPSPLPRPYTHTHTHTHSHTHTSHLPSQTAVCWPAPGFQCGTFVT
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      CPWHPLYCYGRFLHFKPRSHPFPPSPALLCCSLSGTCPGSLIAGYDKDPA
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      PCPHLHRLPARRACPARGFPTPPPPQLSRGGGGGWAGGAPRRDPPPPGSR
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      PAGEGRGCGAGGSTGPGRSPRSDLGGGAGAGAGAGAEPGFAASRSPGPPY
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      KRRAPARERAKRAASGERRAASGERRAASGERRAASGERRAASGAAPRVL
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      PAVPVLVPSRPCWSRGARAGPEPPVLVPRCPCWSRAARAGPQAQGVVRCS
A0A8I3MAL8_PMAIP1-      --------------------------------------------------
                                                                          

A0A8C0N2L6_PMAIP1-      SPRPPAEMPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLL
A0A8I3MAL8_PMAIP1-      --------KGRKKRKSTRPGPGGAPKQLSFECEITLEKYHPFITTKKKMI
                                 *** ***:.***  **::*..** * * *:   :. .:*::

A0A8C0N2L6_PMAIP1-      NLLSKLFRSGT
A0A8I3MAL8_PMAIP1-      NMLSQVLRNGK
                        *:**:::*.*.

© 1998-2023Legal notice