Dataset for protein Noxa of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F4CR18_PMAIP1-      -PARAARDQHGPGPGGAPKQLSFECEITLEKYHPFITTKKKMINMLSQVL
Q1PCT2_PMAIP1-01        MPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLF
                         *.* **..  ***  **::*..** * * *:   :. .:*::*:**:::

A0A5F4CR18_PMAIP1-      RNGK
Q1PCT2_PMAIP1-01        RSGT
                        *.*.

© 1998-2020Legal notice