Dataset for protein Noxa of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C0N2L6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus familiaris GN=PMAIP1 (length=411 residues).
ASCSPIPHLLLQKHLKLSCTVTCPLAVSLSSVQRWSDSHLCRGKALHAVLSGAGNEPSPLPRPYTHTHTHTHSHTHTSHL
PSQTAVCWPAPGFQCGTFVTCPWHPLYCYGRFLHFKPRSHPFPPSPALLCCSLSGTCPGSLIAGYDKDPAPCPHLHRLPA
RRACPARGFPTPPPPQLSRGGGGGWAGGAPRRDPPPPGSRPAGEGRGCGAGGSTGPGRSPRSDLGGGAGAGAGAGAEPGF
AASRSPGPPYKRRAPARERAKRAASGERRAASGERRAASGERRAASGERRAASGAAPRVLPAVPVLVPSRPCWSRGARAG
PEPPVLVPRCPCWSRAARAGPQAQGVVRCSSPRPPAEMPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLL
NLLSKLFRSGT
>gnl|bcl2dbpro|A0A8I3MAL8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus familiaris GN=PMAIP1 (length=53 residues).
KGRKKRKSTRPGPGGAPKQLSFECEITLEKYHPFITTKKKMINMLSQVLRNGK
© 1998-2023Legal notice