Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------apqpspvsspcereggqlqpgdrpp-----g---------------
mqgmpgrvpvrcsgvrsgwvtrptrpgmfrlpem-k-medpqgeedlgddvfp-aegerrarqeqpgkhqqtapgrrgpg
   lgahegtgpgrgpgpprrpgsglcqaqidvfe-evterlcvan-hlpstmtegqla     saspervewlrll ea
         l  a fga gaggapdc npvqypymgseq-d---r- ---ps r sam      -s gapgdg aad rr
                           h    lpl c--s-c a-t n l--   rkg       g             q
                                 l   rv i   vg   a g     a                      
                                     ca            a                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-lrpgaptslqteqqsqpe-p-sr-----lh--paghpcgpglrptspepfat----pa-psqgvmrpcgvtl-------
ptqsasl----l-ap--ldc-lg-pvlrp--lf-lt-c---l-p-a-q-dkr-rsls--s------lr--p-eawgspqp
gr-q-rvlqad-fsgqp--ge -d g parsar --s-qde-c-e-r-s---gqtggshr lfifv--ss-p-l dg r 
shp-sq-a rkhhg-gnagtr ce     hcsp qrtdeacpaeaeelgaltaal   rp nrrrra yplls       
 - lcpav vs r-aagvslg a      arpa ppr p yhma  acl v        w alcha  g rep       
 f   -       v  a   a         p    lp a s s     p            rgpas  r  r        
 e                                  l                        gaa f  l           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aprpaprrssaltvaggtapgiagaqrpggpggrshpsspgspggggqvgpgdrgpaardggrpqravraavsvwgrrpq
sls reqqlltpvp       lrn skkdqmakqptqvasevrreeeawqreigpqqrapadptslqyerrgecg gess
f g   phces  l           ra  al  g sda   cd     la ae a ll m adlnalt         vrm
                                                                             gdr
                                                                               g
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---f-nagdrspaPmsc--dastqtpsppcqaqnhylsamasarklq-vp--m---------------w-----------
slf-g---yglal-a-flepkglplleq-pegfwqhr---qim----c--dqfhrlhmqqhqqnqnrv-wqillflhnla
rgyysfdtgaa-r prt  g-a--rrqsvawt-----aev---qqsgaiaad-r swtdpgkgrrpei i          
qdelqgsr---g- kpa  -t-qsm-g-csl-tgrwgqrrgrgpgetvllslrf ggh  eiwpviqs            
 wg petfklr t -l-  rpvee-q-t --qlspfsgklvmrieplpa rkp        d i                
 vd  prq k  q gdv  a paahhvl gi grk dd gnlfea  n  kgl          a                
     aqe    g            elg  a          h d   d    a                           
      g                    e             f                                      

       330       340       350       360       370         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
---elrrngdgps----------------------------------------------
lnqden-i-aefnqyyprrvfllsyllscshrqmtilrllryivrlvwrlqemqgitym
 aa---t-p----asgqitlwrnnrqapealpssitysrslgtsknsilil        
 drnpg gasavrgrlg pfpqryaniaatpsrraqtpqfkv                 
 qlgap r vvildl d  rmppvpggllggipqpmsifd                   
   l c a rra        gmfdl  g  dffpdcrf                     
          d         e  a       a k  fc                     
                                 c                         
© 1998-2020Legal notice