Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------makqp---------------------
mqglpghvpvrpsggrsgpvrrptrpgrprlyvpmpevtprlgprgrhgpstpe----mrarqegaspervewlrrrgpg
         t ca fpa gagpgsmlcqeg gllrvcrvwit avecgmfqidrggqse      sggapgdg aad rr
                        dgaha  dcge ggps s  pt nnavq pfepl-      g             q
                                  a  ca  c  a   ll g  ysama                     
                                                   a   lgg                      
                                                         e                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            .                                                   
-------------spvssecdreggvlqpadrpPq------------------------------lrpgapts-----q-
prrsarvvqvslredpqcveelgddqfrteegeegprphqqtcpptrplplraalggphrpgrartqq-sllpadlfa-s
sfplspl      qeqppg-a kr-pspalrar argkcdcparaaacsavt      gllaerhr--rg-plrwhspgp
 e  c a      --davpan clpgpg gspa slp paylsa    p         rw rgpgha lq a-lkghgra
             vas gslg asa    tp   p l a sh                as  a  -   - -   dg   
               m  rk   e          e                              s   p r        
                                                                 f              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-lqteqqrlslfplt-c--pglrg-sqp--atgtsspasp-------------------------sqg--r--g------
qpdppls-sh---g-h-cg-----tlaedk--qrl-----gspggggqvgpgdrgpaardggrpql--vm-rs-vterpq
garcrprh--ept-drgpqgspqpp---pasp---atrpsevrreeeawqreigpqqrapadpts-lifalpcsllsess
a-e-as-gnpflevagete mieeaqskggprkpfhssa  cd     la ae a ll m adlnrfvrvavyvrglvrm
s - --pqclagap d da  eanerr  qfg qptqv                           nacar gecwergdr
f s  e   et v             k   ma g  d                            a ye     g g  g
  g       s                   l                                    t            
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---f-nagdrlpapmsc--dkstqtpsppcqaqnhyl-a-a-ar--q------------peqwialhlrrigdnqnr--p
slf-g---y-s-l-a-flepaglplleq-p-gf----s-m-s--qs-cvpadmrrgwhdadifhrqemqqhqqef-ayy-
rgyysfdtgg-a- -r-  ------r--v-e--wqhraevqimpklgai wtrv     -g-g-------g-s--s-vww
qdelqgsr-aagr pla  gtaqsr-qs slttgrwsqrrgrgigetvl rlp      i-s-wdrnpgt-p-aprqrgk
 wg petfklr t kdv  apvaamqgt aa gsp gg gvmfeep pa kga      lqverqigepkravvvlglqg
 vd  prq    g   t       hhll g      d    l da  d             k p  qac f rrl f  d
     aqe                   g             h                   d c  l   a  ki d   
      g                                                        a         da     

       330       340       350       360       370  
....:....|....:....|....:....|....:....|....:....|..
                                                    
r-l-----la--a---------------------------------------
-r-lllhn--ln-denrngagpsrylvrrvwrlsrnlpcslrsqtttprslg
qivffnnyqrsethpqmiilrllqsiqilfiqiqpmqsitymrpdcsiqd  
ltrpqsylflaagpssstqysrrkvtsknsfl vegig  gaqka rcl   
 pnmprka ggl  ipcpmffff          l                  
 l gmpd    g  ff a                                  
   e fa                                             
                                                    
© 1998-2020Legal notice