Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargaargalgcpaerggggraaggglcaapgalnaspglclprslradgqgapgrrrtragrrgarart
                                                               m a eglgcg vggpwr
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 .                              
-------------makqpsdvssecdreggqlqpadrpPqlrpgsptslqteaqsqldcp--r-----------pg--p-
rrsegkgrtkkdq----meppqcveelgddvfpteege-gtq--allkadlfqp------ls-lhlfplthccg--lr-t
tgap c mfqipefepseqed--pan--l-ps--g--- ---  rkgrhsqt--gnpggeghqcpqgspqsrlhhpgsgg
       navq pylge----  ---  - --  -      m    a k --  dlseea d     q agpka  aa a
                                                       r pas                    
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------pqgvdlpcgvteepqrlf-----------a--------mrqsqev
sqedkatqtlfvrrssllsrsssgyfsfdtspaspsmscmkstqtpsp-cqa-ygnagyrlplpnsfpaglpllerppag
ptrtrsssfi                    drspa-------------e---            -hylsamas-gcdsst
efas hpl                            a t ede me   lsp            r         s  kpa
                                                                          a  g  
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  : ::                                                          
paqmraevwiareLrrigDeFnryy----------------------p---------q----------------------
qwdhcpaiqygqk-qcmaqqlhalhkvsagpqsmsgtvvpgpllsvg-rrvsqiltm-qvhtvrqswkgpghqqnqnrvw
rpplpl-rr---- ---s k qgsf gl                   sdplmmgtpvyv gmgagnva aegpsssrqgp
 tnse  --c iq  kfc a  hrq                       amkra eetvm            fer gagsa
   e    e             f l                         eer  assl                     
                                                   a    g                       
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380    
....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                
------------------------------rn--gps---------------------------
swqillflhnvsyptsrawtttlalnaden--la---vspqpgflrltsknvilllsmqgitym
r trtsrsvsfraggpl ssrsrvisswylllgltgwpqlsffiskvsryyscsvwegpnrsrt
g hlccla p           geg qcfwsvpygrarspsvvrvfesqvrspstitrllfq gs
                       f g ctdneasa nqhitsilwcflpqqlrpcrlkf     
                            gag  q  gffgaqa  a hfnldpn g        
                            f       eca  m     gagk l  c        
                                     a   i        i g           
                                                  a             
© 1998-2022Legal notice