Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q45KI9_BAD-01          -------------MFQIPEFEPSEQEDS-------------SPANR----
A0A5F4CJ04_BMF-03      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
A0A5F4CJ04_BMF-02      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
A0A5F4CJ04_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
                                    :**  : **. * .*             .* .*    

Q45KI9_BAD-01          --------GLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHG
A0A5F4CJ04_BMF-03      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVT--EEPQRLFYG
A0A5F4CJ04_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVT--EEPQRLFYG
A0A5F4CJ04_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVT--EEPQRLFYG
                               ** *:.  *..... .  ..: *::  .*    : ..* .:*

Q45KI9_BAD-01          GAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGR
A0A5F4CJ04_BMF-03      NAGYRL-PLPASFPAGL------------PLLEQPPEGQWQHRAEVQIAR
A0A5F4CJ04_BMF-02      NAGYRL-PLPASFPAGL------------PLLEQPPEGQWQHRAEVQIAR
A0A5F4CJ04_BMF-01      NAGYRL-PLPASFPAGL------------PLLEQPPEGQWQHRAEVQIAR
                       .**    .  :*****             *:  .....  :  *  . .*

Q45KI9_BAD-01          ELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNL----
A0A5F4CJ04_BMF-03      KLQCIADQFH---------RLHMQQHQQNQNRVWWQILLFLHNLALNADE
A0A5F4CJ04_BMF-02      KLQCIADQFH---------RLHMQQHQQNQNRVWWQILLFLHNLALNADE
A0A5F4CJ04_BMF-01      KLQCIADQFH---------RLHMQQHQQNQNRVWWQILLFLHNLALNADE
                       :*. ::*:*:         .      * .*.  * .::   .:  *    

Q45KI9_BAD-01          GRGGSAPSQ----------------------------
A0A5F4CJ04_BMF-03      NRNGAGPS-------FQLVPGISCSGAQQDCSCL---
A0A5F4CJ04_BMF-02      NRNGAGPSQSLQIRFWRLSRNLPCSLRSKTTTPQD-G
A0A5F4CJ04_BMF-01      NRNGAGPSQSLQIRFWRLSRNLPCSLRRPATRIRSLG
                       .*.*:.**                             

© 1998-2022Legal notice