Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1PCT2_PMAIP1-01       --------------------------------------------------
J9NWV6_BCL2L11-05      ---------------------------------MAKQPSDVSSECDREGG
J9NTK9_BBC3-01         MQGLPGHVPVRCSGFPSGPVGPPSDLCQARLDVPAPECVPISGPVTRNLL
J9NWV6_BCL2L11-01      ---------TRPAGGRAGGARRGTRPGHPRLYLLEPERASRCGAAGRGGA
J9NTK9_BBC3-03         ----------------------------------MPCVTPRLGPRERHGP
J9NTK9_BBC3-02         ----------------------------------MPCVTPRLGPRERHGP
J9PB65_BMF-04          ---MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEELEDD
J9PB65_BMF-03          -------------------------------------MEPPQCVEELEDD
J9PB65_BMF-02          -------------------------------------MEPPQCVEELEDD
J9PB65_BMF-01          -------------------------------------MEPPQCVEELEDD
F1PK10_BAD-01          ---------------------------MFQIPEFEPSEQEDSSPANRGLG
Q45KI9_BAD-01          ---------------------------MFQIPEFEPSEQEDSSPANRGLG
J9NWV6_BCL2L11-06      ---------------------------------MAKQPSDVSSECDREGG
J9NWV6_BCL2L11-03      ---------------------------------MAKQPSDVSSECDREGG
J9NWV6_BCL2L11-02      ---------------------------------MAKQPSDVSSECDREGG
J9NWV6_BCL2L11-04      ---------------------------------MAKQPSDVSSECDREGG
                                                                         

Q1PCT2_PMAIP1-01       --MPGRKAR-----------------------------------------
J9NWV6_BCL2L11-05      QLQPAERPP-----Q----------------LRPGAPTSLQTEQQ-----
J9NTK9_BBC3-01         QAP-GSAMARARQEGSSPEPVEGLARDGPRPFPLSRL------VPSAVSC
J9NWV6_BCL2L11-01      SGPRGGAGP-----GGGGARGDWLRARGRQSERSCRAVQVSLRSAQPPGL
J9NTK9_BBC3-03         STP-GGQLP-----GA---------RRGPGPRRSAPV------SPQPPG-
J9NTK9_BBC3-02         STP-GGQLP-----GA---------RRGPGPRRSAPV------SPQPPG-
J9PB65_BMF-04          VFQPEDGEP-----G----------------TQPGSLLSADLFAQSQLDC
J9PB65_BMF-03          VFQPEDGEP-----G----------------TQPGSLLSADLFAQSQLDC
J9PB65_BMF-02          VFQPEDGEP-----G----------------TQPGSLLSADLFAQSQLDC
J9PB65_BMF-01          VFQPEDGEP-----G----------------TQPGSLLSADLFAQSQLDC
F1PK10_BAD-01          PSPTGDRPP-----SPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAET
Q45KI9_BAD-01          PSPTGDRPP-----SPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAET
J9NWV6_BCL2L11-06      QLQPAERPP-----Q----------------LRPGAPTSLQTEQQ-----
J9NWV6_BCL2L11-03      QLQPAERPP-----Q----------------LRPGAPTSLQTEQQGNPEG
J9NWV6_BCL2L11-02      QLQPAERPP-----Q----------------LRPGAPTSLQTEQQGNPEG
J9NWV6_BCL2L11-04      QLQPAERPP-----Q----------------LRPGAPTSLQTEQQGNPEG
                                                                         

Q1PCT2_PMAIP1-01       --------------------------------------------------
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NTK9_BBC3-01         GLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
J9NWV6_BCL2L11-01      GLAR-GLRPASPPPPPPPPDSHSRPTRPSPLR-----PASPRAARFAPLP
J9NTK9_BBC3-03         ALGR-VLRPLRARPARRPC-CPCPAARCLPLR-----PHRPARRHRRPGG
J9NTK9_BBC3-02         ALGR-VLRPLRARPARRPC-CPCPAARCLPLR-----PHRPARRHRRPGG
J9PB65_BMF-04          PLSR-----LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCG
J9PB65_BMF-03          PLSR-----LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCG
J9PB65_BMF-02          PLSR-----LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCG
J9PB65_BMF-01          PLSR-----LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCG
F1PK10_BAD-01          R-SR-----HSSFPAGTDEDEGMEEEELSPFRGRS-SSAPPNLCAARRYG
Q45KI9_BAD-01          R-SR-----HSSFPAGTDEDEGMEEEELSPFRGRS-SSAPPNLCAARRYG
J9NWV6_BCL2L11-06      --------------------------------------------------
J9NWV6_BCL2L11-03      E-GD-----RC--PQGSPQGPLAPPASPGPFATRS-----PLFIFVRRSS
J9NWV6_BCL2L11-02      E-GD-----RC--PQGSPQGPLAPPASPGPFATRS-----PLFIFVRRSS
J9NWV6_BCL2L11-04      E-GD-----RC--PQGSPQGPLAPPASPGPFATRS-----PLFIFVRRSS
                                                                         

Q1PCT2_PMAIP1-01       --------------------------------------------------
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NTK9_BBC3-01         PRP--DGPQPSLSPAEQHLESPVP-----------SAPGALAGGPTQAAP
J9NWV6_BCL2L11-01      PPPLW---RPFLGPRPPQCLTLTL------GLRNARKKDQMAKQPSDVSS
J9NTK9_BBC3-03         PPLAWGSPQPAPRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSP
J9NTK9_BBC3-02         PPLAWGSPQPAPRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSP
J9PB65_BMF-04          VTE-----------------------------------------------
J9PB65_BMF-03          VTE-----------------------------------------------
J9PB65_BMF-02          VTE-----------------------------------------------
J9PB65_BMF-01          VTE-----------------------------------------------
F1PK10_BAD-01          REL-----------------------------------------------
Q45KI9_BAD-01          REL-----------------------------------------------
J9NWV6_BCL2L11-06      --------------------------------------------------
J9NWV6_BCL2L11-03      LLS-----------------------------------------------
J9NWV6_BCL2L11-02      LLS-----------------------------------------------
J9NWV6_BCL2L11-04      LLS-----------------------------------------------
                                                                         

Q1PCT2_PMAIP1-01       -------------------------------------------------K
J9NWV6_BCL2L11-05      ------------------------------------------------DR
J9NTK9_BBC3-01         GVRGEEEQWAREIGAQLRRMADDLNALYERRVSVGGGVDGRWDFPPGRGL
J9NWV6_BCL2L11-01      ECDREGGQLQPAERPPQLRPGAPTSLQT-----------------EQQDR
J9NTK9_BBC3-03         GSPGGGGAVGPGDRGPAAADGGRPQRAVRAAGECWGRGRRQVGLPAREGA
J9NTK9_BBC3-02         GSPGGGGAVGPGDRGPAAADGGRPQRAVRAA--------------ETRGA
J9PB65_BMF-04          -------------------------------------EPQRLFYGNAGYR
J9PB65_BMF-03          -------------------------------------EPQRLFYGNAGYR
J9PB65_BMF-02          -------------------------------------EPQRLFYGNAGYR
J9PB65_BMF-01          -------------------------------------EPQRLFYGNAGYR
F1PK10_BAD-01          -------------------------------------RRMSDEFQGSFKG
Q45KI9_BAD-01          -------------------------------------RRMSDEFQGSFKG
J9NWV6_BCL2L11-06      --------------------------------------------------
J9NWV6_BCL2L11-03      -------------------------------------RSSSGYFSFDTDR
J9NWV6_BCL2L11-02      -------------------------------------RSSSGYFSFDTDR
J9NWV6_BCL2L11-04      -------------------------------------RSSSGYFSFDTDR
                                                                         

Q1PCT2_PMAIP1-01       SAQPGPT--RAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT--
J9NWV6_BCL2L11-05      SPAPMSC--DKSTQTPSPPCQAFNHYLSAMVRAIEEGVV-----------
J9NTK9_BBC3-01         RAAPPDV-------RQLLPGAAGSRWGQAGGMGDGPTDLPKGPRRGWHDP
J9NWV6_BCL2L11-01      SPAPMSC--DKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMR-----P
J9NTK9_BBC3-03         AGGPARC--AAAAARRGGVALGTGRWDGRRAHGPAEGPAPRLAR-----P
J9NTK9_BBC3-02         AATPPLTLEGPVQSHHGTPALTQGPWS----------------------P
J9PB65_BMF-04          LPLPASF--PAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
J9PB65_BMF-03          LPLPASF--PAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
J9PB65_BMF-02          LPLPASF--PAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
J9PB65_BMF-01          LPLPASF--PAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
F1PK10_BAD-01          LPRPKSA--GTATQMRQSPSWT--------------------R-------
Q45KI9_BAD-01          LPRPKSA--GTATQMRQSPSWT--------------------R-------
J9NWV6_BCL2L11-06      ------------------------------ASMRQSQAVPADM-------
J9NWV6_BCL2L11-03      SPAPMSC--DKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM-------
J9NWV6_BCL2L11-02      SPAPMSC--DKSTQTPSPPCQAFNHYLSAMGLFE----------------
J9NWV6_BCL2L11-04      SPAPMSC--DKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM-------
                                                                         

Q1PCT2_PMAIP1-01       --------------------------------------------------
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NTK9_BBC3-01         GKGR-----------------DRLERRGASVALGRGD-------------
J9NWV6_BCL2L11-01      EIWI-----------------AQELRRIGDEFNAYYPRRVFLNNYQAAEA
J9NTK9_BBC3-03         GQGP-------------------GPPRAPRRVR--GPRPRGLRAALGGAA
J9NTK9_BBC3-02         GDGA-----------------QLGACTRPVDIRDLGGRTLPPPDALASAG
J9PB65_BMF-04          HQQNQNRVWWQILLFLHNLALNADENRNGAGPR-----------------
J9PB65_BMF-03          HQQNQNRVWWQILLFLHNLALNADENRNGAGPS-------FQLVPGISCS
J9PB65_BMF-02          HQQNQNRVWWQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCS
J9PB65_BMF-01          HQQNQNRVWWQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCS
F1PK10_BAD-01          ----VIQSWW-----------DRNLGRGGSAPSQ----------------
Q45KI9_BAD-01          ----VIQSWW-----------DRNLGRGGSAPSQ----------------
J9NWV6_BCL2L11-06      ----RPEIWI-----------AQELRRIGDEFNAYYPRRVMMFYLLLLLT
J9NWV6_BCL2L11-03      ----RPEIWI-----------AQELRRIGDEFNAYYPRRVFLNNYQAAEA
J9NWV6_BCL2L11-02      --------------------------------------------------
J9NWV6_BCL2L11-04      ----RPEIWI-----------AQELRRIGDEFNAYYPRRLEQ--------
                                                                         

Q1PCT2_PMAIP1-01       -----------------------------
J9NWV6_BCL2L11-05      -----------------------------
J9NTK9_BBC3-01         -----------------------------
J9NWV6_BCL2L11-01      HPQMIILRLLRYIVRLVWRLQ--------
J9NTK9_BBC3-03         HISRAIYSR--------------------
J9NTK9_BBC3-02         DFFCTM-----------------------
J9PB65_BMF-04          -----------------------------
J9PB65_BMF-03          GAQQDCSCL--------------------
J9PB65_BMF-02          LRSKTTTPQD-G-----------------
J9PB65_BMF-01          LRRPATRIRSLG-----------------
F1PK10_BAD-01          -----------------------------
Q45KI9_BAD-01          -----------------------------
J9NWV6_BCL2L11-06      PSPSPQFFFFKVTSKNSILILEMQGITYM
J9NWV6_BCL2L11-03      HPQMIILRLLRYIVRLVWRLQ--------
J9NWV6_BCL2L11-02      -----------------------------
J9NWV6_BCL2L11-04      -----------------------------
                                                    

© 1998-2020Legal notice