Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1PCT2_PMAIP1-01        --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0TVZ9_BMF-05       --------------------------------------------------
A0A8C0TVZ9_BMF-04       --------------------------------------------------
A0A8C0TVZ9_BMF-01       --------------------------------------------------
A0A8C0TVZ9_BMF-02       --------------------------------------------------
A0A8C0TVZ9_BMF-03       --------------------------------------------------
A0A8C0S6I7_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGL
A0A8C0S6I7_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGL
A0A8C0S6I7_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGL
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0SI24_BAD-02       --------------------------------------------------
A0A8C0SI24_BAD-01       --------------------------------------------------
                                                                          

Q1PCT2_PMAIP1-01        --------------------------------------------------
A0A8C0S6I7_BCL2L11      -------------------------------------------MAKQPSD
A0A8C0S6I7_BCL2L11      -------------------------------------------MAKQPSD
A0A8C0TVZ9_BMF-05       -----------------------------------------------MEP
A0A8C0TVZ9_BMF-04       -------------MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEP
A0A8C0TVZ9_BMF-01       -----------------------------------------------MEP
A0A8C0TVZ9_BMF-02       -----------------------------------------------MEP
A0A8C0TVZ9_BMF-03       -----------------------------------------------MEP
A0A8C0S6I7_BCL2L11      CLPRSLRADGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
A0A8C0S6I7_BCL2L11      CLPRSLRADGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
A0A8C0S6I7_BCL2L11      CLPRSLRADGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
A0A8C0S6I7_BCL2L11      -------------------------------------------MAKQPSD
A0A8C0SI24_BAD-02       -------------------------------------MFQIPEFEPSEQE
A0A8C0SI24_BAD-01       -------------------------------------MFQIPEFEPSEQE
                                                                          

Q1PCT2_PMAIP1-01        ---------------------MPGRKARKS--------------------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAP----------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----AS----------
A0A8C0TVZ9_BMF-05       PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLT
A0A8C0TVZ9_BMF-04       PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLT
A0A8C0TVZ9_BMF-01       PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLT
A0A8C0TVZ9_BMF-02       PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLT
A0A8C0TVZ9_BMF-03       PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLT
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQ
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----------------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----------------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQ
A0A8C0SI24_BAD-02       DSSPANRGLGPSPTGDRPP-----SPGKHQQTAPGLLGEAGHQ--QGQPA
A0A8C0SI24_BAD-01       DSSPANRGLGPSPTGDRPP-----SPGKHQQTAPGLLGEAGHQ--QGQPA
                                                     .                    

Q1PCT2_PMAIP1-01        --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0TVZ9_BMF-05       HCCGPGLRPTSQEDKATQTL--------------------SPASPSQGVM
A0A8C0TVZ9_BMF-04       HCCGPGLRPTSQEDKATQTL--------------------SPASPSQGVM
A0A8C0TVZ9_BMF-01       HCCGPGLRPTSQEDKATQTL--------------------SPASPSQGVM
A0A8C0TVZ9_BMF-02       HCCGPGLRPTSQEDKATQTL--------------------SPASPSQGVM
A0A8C0TVZ9_BMF-03       HCCGPGLRPTSQEDKATQTL--------------------SPASPSQGVM
A0A8C0S6I7_BCL2L11      GPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A8C0S6I7_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A8C0S6I7_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A8C0S6I7_BCL2L11      GPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A8C0SI24_BAD-02       SRKHHGGAGAETRSRHSSF--------------------------PAGTD
A0A8C0SI24_BAD-01       SRKHHGGAGAETRSRHSSF--------------------------PAGTD
                                                                          

Q1PCT2_PMAIP1-01        ----------------------------------AQPGPTRAPEELEVEC
A0A8C0S6I7_BCL2L11      ---------------------------------MSCDKSTQTPSPP----
A0A8C0S6I7_BCL2L11      ---------------------------------MRQSQAVPADMRPEIWI
A0A8C0TVZ9_BMF-05       LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQI
A0A8C0TVZ9_BMF-04       LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQI
A0A8C0TVZ9_BMF-01       LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQI
A0A8C0TVZ9_BMF-02       LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQI
A0A8C0TVZ9_BMF-03       LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQI
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAF-----------NHYLSAMASMRQSQAVPADMRPEIWI
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAF-----------NHYLSAMASMRQSQAVPADMRPEIWI
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAF-----------NHYLSAMASMRQSQAVPADMRPEIWI
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAF-----------NHYLSAMASMRQSQAVPADMRPEIWI
A0A8C0SI24_BAD-02       EDEGMEEEELSPF-----------R---------GRSSSAPPNLCAARRY
A0A8C0SI24_BAD-01       EDEGMEEEELSPF-----------R---------GRSSSAPPNLCAARRY
                                                                          

Q1PCT2_PMAIP1-01        AIQLRKFGDKLNFRQ-----------------------------------
A0A8C0S6I7_BCL2L11      -------CQAFNHYL----------------------SAMVRAIEEGVV-
A0A8C0S6I7_BCL2L11      AQELRRIGDEFNAYY----------------------PRRLARILTSYL-
A0A8C0TVZ9_BMF-05       ARKLQCIADQFHRLH-------------------------------MQQV
A0A8C0TVZ9_BMF-04       ARKLQCIADQFHRLH-------------------------------MQQ-
A0A8C0TVZ9_BMF-01       ARKLQCIADQFHRLH-------------------------------MQQ-
A0A8C0TVZ9_BMF-02       ARKLQCIADQFHRLH-------------------------------MQQ-
A0A8C0TVZ9_BMF-03       ARKLQCIADQFHRLH-------------------------------MQQ-
A0A8C0S6I7_BCL2L11      AQELRRIGDEFNAYY----------------------PRRVMM-------
A0A8C0S6I7_BCL2L11      AQELRRIGDEFNAYY----------------------PRRVMM-------
A0A8C0S6I7_BCL2L11      AQELRRIGDEFNAYY----------------------PRRV---------
A0A8C0S6I7_BCL2L11      AQELRRIGDEFNAYY----------------------PRRLEQ-------
A0A8C0SI24_BAD-02       GRELRRMSDEFQGSFKGL-------------------PRPKSAGTATQM-
A0A8C0SI24_BAD-01       GRELRRMSDEFQGSFKVSAGPQSMSGTVVPGPLLSVGPDPESQGLPVSVV
                                : ::                                      

Q1PCT2_PMAIP1-01        --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0TVZ9_BMF-05       GMGAGSWAGAGGESSGAGGWGWTRTCLSHSVSAGTPRAWSRGLGLGCCGS
A0A8C0TVZ9_BMF-04       -----------HQQNQNRVW-WQILLFLHN------------LALNADEN
A0A8C0TVZ9_BMF-01       -----------HQQNQNRVW-WQILLFLHN------------LALNADEN
A0A8C0TVZ9_BMF-02       -----------HQQNQNRVW-WQILLFLHN------------LALNADEN
A0A8C0TVZ9_BMF-03       -----------HQQNQNRVW-WQILLFLHN------------LALNADEN
A0A8C0S6I7_BCL2L11      -----------------------------------------------FYL
A0A8C0S6I7_BCL2L11      -----------------------------------------------FYL
A0A8C0S6I7_BCL2L11      ------------------------------------------------FL
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0SI24_BAD-02       ----------------RQSPSW-------------------TRVIQSWWD
A0A8C0SI24_BAD-01       HTVRQNVKGPEFPRSSRRGARWHLCSRAVPFRYPGSLASTTSEFLSSWTA
                                                                          

Q1PCT2_PMAIP1-01        --------------------KLLNLLSKLFRSGT
A0A8C0S6I7_BCL2L11      ----------------------------------
A0A8C0S6I7_BCL2L11      ----------------------------------
A0A8C0TVZ9_BMF-05       GELGGPNCPSTPALSELQVGYLPPLGSGF-----
A0A8C0TVZ9_BMF-04       RNGAGPR---------------------------
A0A8C0TVZ9_BMF-01       RNGAGPSQSLQIRFWRLSRNLPCSLR--------
A0A8C0TVZ9_BMF-02       RNGAGPSFQLVPGISCSGAQQDCSCL--------
A0A8C0TVZ9_BMF-03       RNGAGPSVFIAV-FLRLHFKSVSLCT--------
A0A8C0S6I7_BCL2L11      LLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
A0A8C0S6I7_BCL2L11      LLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
A0A8C0S6I7_BCL2L11      NNYQAAEAHPQMIILRLLRYIVRLVWRLQ-----
A0A8C0S6I7_BCL2L11      ----------------------------------
A0A8C0SI24_BAD-02       RNLGRGGSAPSQ----------------------
A0A8C0SI24_BAD-01       VPASRGWVSGSSGVLAFSPRAPGTVCLGPNQSRS
                                                          

© 1998-2022Legal notice