Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A8C0S6I7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=241 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARART
RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHY
LSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITY
M
>gnl|bcl2dbpro|A0A8C0S6I7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=233 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARART
RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHY
LSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A8C0S6I7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVV
>gnl|bcl2dbpro|A0A8C0S6I7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=297 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARART
RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPG
PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIA
QELRRIGDEFNAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
>gnl|bcl2dbpro|A0A8C0S6I7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C0S6I7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RILTSYL
>gnl|bcl2dbpro|A0A8C0SI24_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A8C0SI24_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=244 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKVSAGPQSMSGTVVPGPLLSVGPDPESQGLPVSVV
HTVRQNVKGPEFPRSSRRGARWHLCSRAVPFRYPGSLASTTSEFLSSWTAVPASRGWVSGSSGVLAFSPRAPGTVCLGPN
QSRS
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=218 residues).
MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQ
HRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=231 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAGSWA
GAGGESSGAGGWGWTRTCLSHSVSAGTPRAWSRGLGLGCCGSGELGGPNCPSTPALSELQVGYLPPLGSGF
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCSLR
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=202 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSVFIAVFLRLHFKSVSLCT
>gnl|bcl2dbpro|Q1PCT2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus familiaris GN=PMAIP1 (length=54 residues).
MPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT
© 1998-2022Legal notice