Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bcl2dbpro|F1PK10_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|J9NTK9_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=268 residues).
MPCVTPRLGPRERHGPSTPGGQLPGARRGPGPRRSAPVSPQPPGALGRVLRPLRARPARRPCCPCPAARCLPLRPHRPAR
RHRRPGGPPLAWGSPQPAPRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVGPGDRGPAAADGGR
PQRAVRAAGECWGRGRRQVGLPAREGAAGGPARCAAAAARRGGVALGTGRWDGRRAHGPAEGPAPRLARPGQGPGPPRAP
RRVRGPRPRGLRAALGGAAHISRAIYSR
>gnl|bcl2dbpro|J9NTK9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=293 residues).
MQGLPGHVPVRCSGFPSGPVGPPSDLCQARLDVPAPECVPISGPVTRNLLQAPGSAMARARQEGSSPEPVEGLARDGPRP
FPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHL
ESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRVSVGGGVDGRWDFPPGRGLRAAPPDVRQL
LPGAAGSRWGQAGGMGDGPTDLPKGPRRGWHDPGKGRDRLERRGASVALGRGD
>gnl|bcl2dbpro|J9NTK9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=240 residues).
MPCVTPRLGPRERHGPSTPGGQLPGARRGPGPRRSAPVSPQPPGALGRVLRPLRARPARRPCCPCPAARCLPLRPHRPAR
RHRRPGGPPLAWGSPQPAPRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVGPGDRGPAAADGGR
PQRAVRAAETRGAAATPPLTLEGPVQSHHGTPALTQGPWSPGDGAQLGACTRPVDIRDLGGRTLPPPDALASAGDFFCTM
>gnl|bcl2dbpro|J9NWV6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|J9NWV6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE
>gnl|bcl2dbpro|J9NWV6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=301 residues).
TRPAGGRAGGARRGTRPGHPRLYLLEPERASRCGAAGRGGASGPRGGAGPGGGGARGDWLRARGRQSERSCRAVQVSLRS
AQPPGLGLARGLRPASPPPPPPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLWRPFLGPRPPQCLTLTLGLRNARKKD
QMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQA
VPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|J9NWV6_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=118 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVM
MFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
>gnl|bcl2dbpro|J9NWV6_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVV
>gnl|bcl2dbpro|J9NWV6_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|J9PB65_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=212 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCSLRSKTTTPQDG
>gnl|bcl2dbpro|J9PB65_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=218 residues).
MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQ
HRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|J9PB65_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
>gnl|bcl2dbpro|J9PB65_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=213 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCSLRRPATRIRSLG
>gnl|bcl2dbpro|Q1PCT2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus familiaris GN=PMAIP1 (length=54 residues).
MPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT
>gnl|bcl2dbpro|Q45KI9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGR
GGSAPSQ
© 1998-2020Legal notice