Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  **********************************************
----------------------------------MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
mgareglgcgrvggpwrtgapgcgnavqdpylge                                              
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQ
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************             :..    * *    : *.            *.*..  . : .
HRAEVQIARKLQCIADQFHRLHMQQ------------hqqnqnrvW-WqillflHn------------LaLnadenrnga
                         vgmgagswagaggessgagg g trtcls svsagtprawsrg g gccgsgelg
                                                                                
                                                                                
                                                                                

       250       260     
....:....|....:....|....:
**                       
GPs--l-p-fsrl-----csl----
  rvs-v-r----svqyv--ctsgf
  nqqstvglwesqrnspsp-r   
   fpiqiailc hfkqlpl l   
   cf a      gagld   g   
© 1998-2022Legal notice