Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  **********************************************
----------------------------------MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
mgareglgcgrvggpwrtgapgcgnavqdpylge                                              
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQ
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************************                       
HRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPs-------wrlsrnlpcslr---
                                                         rqslqirf------------sqt
                                                                 fq vpgis  garpd
                                                                             qka

       
....:..
       
t------
-tprslg
csiqd  
 rcl   
© 1998-2020Legal notice