Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
                                                                                
                                                                                

       170       180       190       200       210   
....:....|....:....|....:....|....:....|....:....|...
************************       :.*  .:.**            
WQILLFLHNLALNADENRNGAGPSqslqirfwrLsrnlpCSlrsqtttpr--g
                        -------fq vpgis  garpdcsiqsl-
                                           qka rcld  
© 1998-2022Legal notice