Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************************************************   . .  *
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQhqqnqnrvW
                                                                       vgtgags- 
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *    : *.:: .:                 :    .: *.                         
--------------WqillflHnlalnadenrngagps-------wrlsrnlpCslrqqdtspl----------------
agaggesagaggwg trtcls svsagtpra-------qslqirffqrvpgis cga---c-c-spstpalselqvgylp
                                              s gl  g   sspt-t-rdlg             
                                                         rklgriqcg              
                                                         gea g n                

      
....:.
      
------
plgsgf
      
      
      
© 1998-2023Legal notice