Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F4CJ04_BMF-03      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
A0A5F4CJ04_BMF-02      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
A0A5F4CJ04_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
                       **************************************************

A0A5F4CJ04_BMF-03      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A5F4CJ04_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A5F4CJ04_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A5F4CJ04_BMF-03      GYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
A0A5F4CJ04_BMF-02      GYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
A0A5F4CJ04_BMF-01      GYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
                       **************************************************

A0A5F4CJ04_BMF-03      QHQQNQNRVWWQILLFLHNLALNADENRNGAGPS-------FQLVPGISC
A0A5F4CJ04_BMF-02      QHQQNQNRVWWQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPC
A0A5F4CJ04_BMF-01      QHQQNQNRVWWQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPC
                       **********************************       :.*  .:.*

A0A5F4CJ04_BMF-03      SGAQQDCSCL---
A0A5F4CJ04_BMF-02      SLRSKTTTPQD-G
A0A5F4CJ04_BMF-01      SLRRPATRIRSLG
                       *            

© 1998-2022Legal notice