Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0TVZ9_BMF-05      ----------------------------------MEPPQCVEELEDDVFQ
A0A8C0TVZ9_BMF-04      MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEELEDDVFQ
A0A8C0TVZ9_BMF-01      ----------------------------------MEPPQCVEELEDDVFQ
A0A8C0TVZ9_BMF-02      ----------------------------------MEPPQCVEELEDDVFQ
A0A8C0TVZ9_BMF-03      ----------------------------------MEPPQCVEELEDDVFQ
                                                         ****************

A0A8C0TVZ9_BMF-05      PEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE
A0A8C0TVZ9_BMF-04      PEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE
A0A8C0TVZ9_BMF-01      PEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE
A0A8C0TVZ9_BMF-02      PEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE
A0A8C0TVZ9_BMF-03      PEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE
                       **************************************************

A0A8C0TVZ9_BMF-05      DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A8C0TVZ9_BMF-04      DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A8C0TVZ9_BMF-01      DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A8C0TVZ9_BMF-02      DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
A0A8C0TVZ9_BMF-03      DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPL
                       **************************************************

A0A8C0TVZ9_BMF-05      LEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAGSWAGAGGES
A0A8C0TVZ9_BMF-04      LEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ------------HQQ
A0A8C0TVZ9_BMF-01      LEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ------------HQQ
A0A8C0TVZ9_BMF-02      LEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ------------HQQ
A0A8C0TVZ9_BMF-03      LEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ------------HQQ
                       ***********************************             :.

A0A8C0TVZ9_BMF-05      SGAGGWGWTRTCLSHSVSAGTPRAWSRGLGLGCCGSGELGGPNCPSTPAL
A0A8C0TVZ9_BMF-04      NQNRVW-WQILLFLHN------------LALNADENRNGAGPR-------
A0A8C0TVZ9_BMF-01      NQNRVW-WQILLFLHN------------LALNADENRNGAGPSQSLQIRF
A0A8C0TVZ9_BMF-02      NQNRVW-WQILLFLHN------------LALNADENRNGAGPSFQLVPGI
A0A8C0TVZ9_BMF-03      NQNRVW-WQILLFLHN------------LALNADENRNGAGPSVFIAV-F
                       .    * *    : *.            *.*..  . : .**        

A0A8C0TVZ9_BMF-05      SELQVGYLPPLGSGF
A0A8C0TVZ9_BMF-04      ---------------
A0A8C0TVZ9_BMF-01      WRLSRNLPCSLR---
A0A8C0TVZ9_BMF-02      SCSGAQQDCSCL---
A0A8C0TVZ9_BMF-03      LRLHFKSVSLCT---
                                      

© 1998-2022Legal notice