Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9PB65_BMF-04      MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEELEDDVFQPEDGEPGTQP
J9PB65_BMF-03      ----------------------------------MEPPQCVEELEDDVFQPEDGEPGTQP
J9PB65_BMF-02      ----------------------------------MEPPQCVEELEDDVFQPEDGEPGTQP
J9PB65_BMF-01      ----------------------------------MEPPQCVEELEDDVFQPEDGEPGTQP
                                                     **************************

J9PB65_BMF-04      GSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
J9PB65_BMF-03      GSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
J9PB65_BMF-02      GSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
J9PB65_BMF-01      GSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
                   ************************************************************

J9PB65_BMF-04      GVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHR
J9PB65_BMF-03      GVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHR
J9PB65_BMF-02      GVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHR
J9PB65_BMF-01      GVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHR
                   ************************************************************

J9PB65_BMF-04      LHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR----------------------
J9PB65_BMF-03      LHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPS-------FQLVPGISCSGAQQD
J9PB65_BMF-02      LHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCSLRSKT
J9PB65_BMF-01      LHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCSLRRPA
                   *************************************                       

J9PB65_BMF-04      -------
J9PB65_BMF-03      CSCL---
J9PB65_BMF-02      TTPQD-G
J9PB65_BMF-01      TRIRSLG
                          

© 1998-2020Legal notice