Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=218 residues).
MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSR
LHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQ
HRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=231 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAGSWA
GAGGESSGAGGWGWTRTCLSHSVSAGTPRAWSRGLGLGCCGSGELGGPNCPSTPALSELQVGYLPPLGSGF
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSQSLQIRFWRLSRNLPCSLR
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
>gnl|bcl2dbpro|A0A8C0TVZ9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=202 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSVFIAVFLRLHFKSVSLCT
© 1998-2022Legal notice