Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
trpaggraggarrgtrpghprlylleperasrcgaagrggasgprggagpggggargdwlrargrqserscravqvslrs
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aqppglglarglrpasppppppppdshsrptrpsplrpaspraarfaplpppplwrpflgprppqcltltlglrnarkkd
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *****************************************                                      
-MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ--------------------------------------
q                                         gnpegegdrcpqgspqgplappaspgpfatrsplfifv
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------drspapmscdkstqtpsppcqafnhylsamasmrqsqavpadmrpeiwiaqelrrigdefna
rrssllsrsssgyfsfdt------------------------------vrfi----------------------------
                                                glaeeegv                        
                                                                                

       330       340       350       360     
....:....|....:....|....:....|....:....|....:
                                             
yyprrv---------------------------------------
------flnnyqaaeahpqmiilrllryivrlvwrlqemqgitym
     lmqfyllllltpspspqffffkvtsknsilil        
      em                                     
© 1998-2020Legal notice