Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargarpghprlylleperasrcgargalgcpaerggggpggraaggglcaapgalnarscravqvslrs
tr  ggraggar  t                    a tg asgp   a    gg r dwlr r rqse            
                                     r                                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aqspglclprslrpaspppppppppadgqgapgrrsplrpaspraarfaplpppplwrtragrrgarartrrsegkgrtk
  p   g a g              p shsr t p                       pfl p ppqcl ltlglrnar 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *****************************************                                    
---MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ------------------------------------
kdq                                         gnpegegdrcpqgspqgplappaspgpfatrsplfi
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  ******************************
--------------------drspapmscdkstqtpsppcqafnhylsamASMRQSQAVPADMRPEIWIAQELRRIGDEF
fvrrssllsrsssgyfsfdt------------------------------                              
                                                                                
                                                                                

       330       340       350       360       
....:....|....:....|....:....|....:....|....:..
*******:                                       
NAYYPRRv---flnny-------------------------------
       leri----lqaaeahpqmiilrllryivrlvwrlqgitym
        aqfltsy-ltpsps  ffffkvtsknsi ilem      
        mm y ll                                
© 1998-2023Legal notice