Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0S6I7_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGL
A0A8C0S6I7_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGL
A0A8C0S6I7_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAAGGGLCAAPGALNASPGL
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
A0A8C0S6I7_BCL2L11      --------------------------------------------------
                                                                          

A0A8C0S6I7_BCL2L11      CLPRSLRADGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
A0A8C0S6I7_BCL2L11      CLPRSLRADGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
A0A8C0S6I7_BCL2L11      CLPRSLRADGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
A0A8C0S6I7_BCL2L11      -------------------------------------------MAKQPSD
A0A8C0S6I7_BCL2L11      -------------------------------------------MAKQPSD
A0A8C0S6I7_BCL2L11      -------------------------------------------MAKQPSD
                                                                   *******

A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQ
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----------------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----------------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQ
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----------------
A0A8C0S6I7_BCL2L11      VSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ----------------
                        **********************************                

A0A8C0S6I7_BCL2L11      GPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A8C0S6I7_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A8C0S6I7_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A8C0S6I7_BCL2L11      GPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A8C0S6I7_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A8C0S6I7_BCL2L11      --------------------------------------------ASMRQS
                                                                    *.*  .

A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEF
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEF
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEF
A0A8C0S6I7_BCL2L11      KSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEF
A0A8C0S6I7_BCL2L11      --------------------------KSTQTPSPP-----------CQAF
A0A8C0S6I7_BCL2L11      --------------------------QAVPADMRPEIWIAQELRRIGDEF
                                                  ::. :   *            : *

A0A8C0S6I7_BCL2L11      NAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
A0A8C0S6I7_BCL2L11      NAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGITYM
A0A8C0S6I7_BCL2L11      NAYYPRRV---FLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ-----
A0A8C0S6I7_BCL2L11      NAYYPRRLEQ-------------------------------------
A0A8C0S6I7_BCL2L11      NHYLSAMVRAIEEGVV-------------------------------
A0A8C0S6I7_BCL2L11      NAYYPRRLARILTSYL-------------------------------
                        * * .  :                                       

© 1998-2022Legal notice