Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9NWV6_BCL2L11-01      TRPAGGRAGGARRGTRPGHPRLYLLEPERASRCGAAGRGGASGPRGGAGP
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NWV6_BCL2L11-06      --------------------------------------------------
J9NWV6_BCL2L11-03      --------------------------------------------------
J9NWV6_BCL2L11-02      --------------------------------------------------
J9NWV6_BCL2L11-04      --------------------------------------------------
                                                                         

J9NWV6_BCL2L11-01      GGGGARGDWLRARGRQSERSCRAVQVSLRSAQPPGLGLARGLRPASPPPP
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NWV6_BCL2L11-06      --------------------------------------------------
J9NWV6_BCL2L11-03      --------------------------------------------------
J9NWV6_BCL2L11-02      --------------------------------------------------
J9NWV6_BCL2L11-04      --------------------------------------------------
                                                                         

J9NWV6_BCL2L11-01      PPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLWRPFLGPRPPQCLTLT
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NWV6_BCL2L11-06      --------------------------------------------------
J9NWV6_BCL2L11-03      --------------------------------------------------
J9NWV6_BCL2L11-02      --------------------------------------------------
J9NWV6_BCL2L11-04      --------------------------------------------------
                                                                         

J9NWV6_BCL2L11-01      LGLRNARKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTE
J9NWV6_BCL2L11-05      -----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTE
J9NWV6_BCL2L11-06      -----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTE
J9NWV6_BCL2L11-03      -----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTE
J9NWV6_BCL2L11-02      -----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTE
J9NWV6_BCL2L11-04      -----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTE
                                  ***************************************

J9NWV6_BCL2L11-01      QQ------------------------------------------------
J9NWV6_BCL2L11-05      QQ------------------------------------------------
J9NWV6_BCL2L11-06      QQ------------------------------------------------
J9NWV6_BCL2L11-03      QQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
J9NWV6_BCL2L11-02      QQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
J9NWV6_BCL2L11-04      QQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSS
                       **                                                

J9NWV6_BCL2L11-01      --------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPAD
J9NWV6_BCL2L11-05      --------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVV---
J9NWV6_BCL2L11-06      --------------------------------------ASMRQSQAVPAD
J9NWV6_BCL2L11-03      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPAD
J9NWV6_BCL2L11-02      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE--------
J9NWV6_BCL2L11-04      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPAD
                                                                         

J9NWV6_BCL2L11-01      MRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIV
J9NWV6_BCL2L11-05      --------------------------------------------------
J9NWV6_BCL2L11-06      MRPEIWIAQELRRIGDEFNAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTS
J9NWV6_BCL2L11-03      MRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIV
J9NWV6_BCL2L11-02      --------------------------------------------------
J9NWV6_BCL2L11-04      MRPEIWIAQELRRIGDEFNAYYPRRLEQ----------------------
                                                                         

J9NWV6_BCL2L11-01      RLVWRLQ--------
J9NWV6_BCL2L11-05      ---------------
J9NWV6_BCL2L11-06      KNSILILEMQGITYM
J9NWV6_BCL2L11-03      RLVWRLQ--------
J9NWV6_BCL2L11-02      ---------------
J9NWV6_BCL2L11-04      ---------------
                                      

© 1998-2020Legal notice