Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0NKD6_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      TRPAGGRAGGARRGTRPGHPRLYLLEPERASRCGAAGRGGASGPRGGAGP
A0A8I3N1T0_BCL2L11      MFPAAAAGAARARGA-------------------ARGTLGCPAERGGGG-
A0A8C0NKD6_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      MFPAAAAGAARARGA-------------------ARGALGCPAERGGG--
A0A8C0NKD6_BCL2L11      MFPAAAAGAARARGA-------------------ARGALGCPAERGGG--
A0A8C0NKD6_BCL2L11      MFPAAAAGAARARGA-------------------ARGALGCPAERGGG--
A0A8I3N6G2_BCL2L11      MFPAAAAGAARARGA-------------------ARGALGCPAERGGG--
                                                                          

A0A8C0NKD6_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      GGGGARGDWLRARGRQSERSCRAVQVSLRSAQPPGLGLARGLRPASPPPP
A0A8I3N1T0_BCL2L11      GGRAAGGGLCAAPGALNA--------------SPGLCLPRSLR-------
A0A8C0NKD6_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      GGRAAGGGLCAAPGALNA--------------SPGLCLPRSLR-------
A0A8C0NKD6_BCL2L11      GGRAAGGGLCAAPGALNA--------------SPGLCLPRSLR-------
A0A8C0NKD6_BCL2L11      GGRAAGGGLCAAPGALNA--------------SPGLCLPRSLR-------
A0A8I3N6G2_BCL2L11      GGRAAGGGLCAAPGALNA--------------SPGLCLPRSLR-------
                                                                          

A0A8C0NKD6_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      PPPPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLWRPFLGPRPPQCLT
A0A8I3N1T0_BCL2L11      -----ADGQGAPGRR----------------------RTRAGRRGARART
A0A8C0NKD6_BCL2L11      --------------------------------------------------
A0A8I3N1T0_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      --------------------------------------------------
A0A8I3N6G2_BCL2L11      -----ADGQGAPGRR----------------------RTRAGRRGARART
A0A8C0NKD6_BCL2L11      -----ADGQGAPGRR----------------------RTRAGRRGARART
A0A8C0NKD6_BCL2L11      -----ADGQGAPGRR----------------------RTRAGRRGARART
A0A8I3N6G2_BCL2L11      -----ADGQGAPGRR----------------------RTRAGRRGARART
                                                                          

A0A8C0NKD6_BCL2L11      -------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N1T0_BCL2L11      -------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N6G2_BCL2L11      -------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N1T0_BCL2L11      LTLGLRNARKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N1T0_BCL2L11      RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8C0NKD6_BCL2L11      -------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N1T0_BCL2L11      -------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N6G2_BCL2L11      -------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N6G2_BCL2L11      RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8C0NKD6_BCL2L11      RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8C0NKD6_BCL2L11      RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
A0A8I3N6G2_BCL2L11      RRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQ
                                     *************************************

A0A8C0NKD6_BCL2L11      TEQQ----------------------------------------------
A0A8I3N1T0_BCL2L11      TEQQ----------------------------------------------
A0A8I3N6G2_BCL2L11      TEQQ----------------------------------------------
A0A8I3N1T0_BCL2L11      TEQQ----------------------------------------------
A0A8I3N1T0_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A8C0NKD6_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A8I3N1T0_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A8I3N6G2_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A8I3N6G2_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A8C0NKD6_BCL2L11      TEQQ----------------------------------------------
A0A8C0NKD6_BCL2L11      TEQQ----------------------------------------------
A0A8I3N6G2_BCL2L11      TEQQ----------------------------------------------
                        ****                                              

A0A8C0NKD6_BCL2L11      ----------------------------------------ASMRQSQAVP
A0A8I3N1T0_BCL2L11      ----------------------------------------ASMRQSQAVP
A0A8I3N6G2_BCL2L11      ----------------------------------------ASMRQSQAVP
A0A8I3N1T0_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8I3N1T0_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8C0NKD6_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8I3N1T0_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8I3N6G2_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8I3N6G2_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8C0NKD6_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8C0NKD6_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
A0A8I3N6G2_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP
                                                                **********

A0A8C0NKD6_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRLARILTSYL--------------
A0A8I3N1T0_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRLARILTSYL--------------
A0A8I3N6G2_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRLARILTSYL--------------
A0A8I3N1T0_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRV---FLNNYQAAEAHPQMIILRL
A0A8I3N1T0_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRV---FLNNYQAAEAHPQMIILRL
A0A8C0NKD6_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRLEQ--------------------
A0A8I3N1T0_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRLEQ--------------------
A0A8I3N6G2_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRLEQ--------------------
A0A8I3N6G2_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRV---FLNNYQAAEAHPQMIILRL
A0A8C0NKD6_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRVMMFYLLLLLTPSPSPQFFFFKV
A0A8C0NKD6_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRV---FLNNYQAAEAHPQMIILRL
A0A8I3N6G2_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYPRRV---FLNNYQAAEAHPQMIILRL
                        ***************************:                      

A0A8C0NKD6_BCL2L11      -----------------
A0A8I3N1T0_BCL2L11      -----------------
A0A8I3N6G2_BCL2L11      -----------------
A0A8I3N1T0_BCL2L11      LRYIVRLVWRLQ-----
A0A8I3N1T0_BCL2L11      LRYIVRLVWRLQ-----
A0A8C0NKD6_BCL2L11      -----------------
A0A8I3N1T0_BCL2L11      -----------------
A0A8I3N6G2_BCL2L11      -----------------
A0A8I3N6G2_BCL2L11      LRYIVRLVWRLQ-----
A0A8C0NKD6_BCL2L11      TSKNSILILEMQGITYM
A0A8C0NKD6_BCL2L11      LRYIVRLVWRLQ-----
A0A8I3N6G2_BCL2L11      LRYIVRLVWRLQ-----
                                         

© 1998-2023Legal notice