Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A5F4C1I1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=301 residues).
TRPAGGRAGGARRGTRPGHPRLYLLEPERASRCGAAGRGGASGPRGGAGPGGGGARGDWLRARGRQSERSCRAVQVSLRS
AQPPGLGLARGLRPASPPPPPPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLWRPFLGPRPPQCLTLTLGLRNARKKD
QMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQA
VPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A5F4C1I1_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
© 1998-2020Legal notice