Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A8C0NKD6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=234 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARAR
TRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A8C0NKD6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=242 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARAR
TRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQGIT
YM
>gnl|bcl2dbpro|A0A8C0NKD6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C0NKD6_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RILTSYL
>gnl|bcl2dbpro|A0A8I3N1T0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8I3N1T0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=303 residues).
TRPAGGRAGGARRGTRPGHPRLYLLEPERASRCGAAGRGGASGPRGGAGPGGGGARGDWLRARGRQSERSCRAVQVSLRS
AQPPGLGLARGLRPASPPPPPPPPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLWRPFLGPRPPQCLTLTLGLRNARK
KDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQS
QAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A8I3N1T0_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=291 residues).
MFPAAAAGAARARGAARGTLGCPAERGGGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARA
RTRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPAS
PGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIW
IAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A8I3N1T0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RILTSYL
>gnl|bcl2dbpro|A0A8I3N6G2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8I3N6G2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=234 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARAR
TRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A8I3N6G2_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RILTSYL
>gnl|bcl2dbpro|A0A8I3N6G2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=290 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGGRAAGGGLCAAPGALNASPGLCLPRSLRADGQGAPGRRRTRAGRRGARAR
TRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASP
GPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWI
AQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
© 1998-2023Legal notice