Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaatraarprggvrwkvyrtvrssllpprrrslvaapltlrpspplclrwclsllpqrvwgssprvvvtrgppsrpw
          ma aaafgaqgcpaerggglagpagac  agc nlp gaaalhafrgdgngpparrkarlgrldagaear
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssecdregrq---------lqpaerpp-------------------------------
mkcgvgsawacpcqvprasqscwvplemc--vpslslaeqhf-aedge-ggqlpgarrglgprrpaplpawppgalgrvl
tmrsekktrswspe--meepqlve-tqddepr         -t-gps-l                               
hlp kaermtqqssreps aei--saat-lt-         vsl---aa                               
 hd   amlpkmlppr l  adfm  llsasp         srhvtpt                                
        kfakhhgg g    e    cg qf         gg rsm                                 
        c  id f               g          ed la                                  
                                          a                                     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------qlrpgaptslqtepqgnpegnhg----s-lhg-------p---------
rplrvrparhprrprlaarclplrprsptrrgtqg-sll-adl---------l-gegd-c---scgpglr-qgplappas
                         grgkh ---apg--q---favslldcp-srsqlfphthcaiava atsqrgedka
                               rvv-a-qplhgppvrpdgsqepeqltala qlg a      r    ggr
                               hrt  vdshewgg leqarpsq n ss s a a                
                               eql  r ke add   p phqm   d                       
                               aae  l  a         lec                            
                                 a                 a                            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------sp---------v------g------drspapmscdkstqtpsppcqaf------nhylsa-a--rqsqaepag
pgpfatr--lfifvrrss-lsrsss-yfsfdt-----------------------egpvqswqh---m-sm---------
tqtlspa  sqgvmlpcgateepqrlfygnagyhlslaarfpavlplgeq pegq      ---tvwlrrtpsvrvygvq
sh gg          gg  vgpgda pvetrsr pqy vgteetrgmeae spfr      hrsrqsrsqr prplrepa
                          aaa   g   r   aa de aa a  l l      gdgmplg cg ladgpdl 
                                                             qardm   aa     da  
                                                             d ma               
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m----rpeiwiaq----elrrigdefnayyprrv----------------------------------------------
-ysptla-vq--rrigrkvqcmagqlhrlh----nlilpfchrkevcleafpvlpswasqsaywttirdrsintccakgq
lgacg--t--pr-dy dqtsavvad-a--qvqqlswwryqssgswwsrvqnqltrtlprpvwrrhrvqqsgwevrngrap
g    penylawv   adalgss v -nw-ellrrklqsshtpttprqsylvemalkwllltflsprmlpwlsrnlrq l
a    e fq dst    v adq  r vftmlginqisplleremplpvrpsrsplyqvqvrstfrnmlhnnekn g a g
        l   p    c   l  k ldslkd imenndiai dhflmplqnrngmprpnplsmfkliell d       
            l        f  a  crf    l eka  a  g h lkpli eaimiehkm cgka fa         
            e               f     f             kiaag d   faggi a g             
                                  e             hh  f        dh   e             
                                  a                          c                  

       410       420       430         
....:....|....:....|....:....|....:....
                                       
---------------------------------------
riiseissrtwvpahstlpwpvlltvfpsnvqdilmeri
srqpqqrgmlmp smtrsrraghfsacgelqprv     
gfpeklkfgegn lgpiic     h   dfphpl     
 ae gk          a             laa      
    a                                  
                                       
                                       
                                       
                                       
© 1998-2023Legal notice