Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rkppaltrrprrrvhargvvvrplnrsrrrsgrrgllpgpgtrspspgqcprrvsrpvsqtptprtvsgwgrgegggsal
mf a ah aala ga p asgcaaeprgglaa p gcaag dlnaggelmllpclphdmspvpivrtlrv l        
                                                  gahacagcgegqegapkfcl k        
                                                          a a dc g a a          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------ps------------
grlvwahrclgglaglftnngvrarqrplaasatpgkrvdrgvpspstvqrtqgaarrkrdqmgkq--dvssecistpvy
                                        tstvqtprtlmsglyyftypsptartcpgtvtgtgqraiq
                                        palhprkqsgkpe kvehvnktr ar lpsppngfl   e
                                          a e akkc lc gr aggh q  l   aaa a      
                                                   ga                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------dregrqlqpae-------------------------------pp--r--a-------------ptsl---p--
sslvgvw-----------agywprarlaggagarggggggcdsgvgrlr--ql-pg-glwicrclawapg----qte-qg
laal lrmpaqggcrwgt                              g qwspasr             slrvrasqrp
h      gkspvvsar p                              c grgggp               iqssgr ea
       eac qag   c                                 fe  c               cma  g   
       a         a                                                     al       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------drspapmscdk
ssttpvggvadsgprpspqgrlapsavsgemsevrplssdifmetllceqfvdpltmevvggsdpeedl-----------
nppgnlewlgrdcligftlapavap srcplctsslpftpvrrssvpsryssgyfsppa taalggprwppvedslevme
egee h  e   aihaa a a   a ap gfa rg  aifaapal  aaslca aaf           t ggss vwrpp
ad                                                                     a r rp gc
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   .                   :.* :                    
stqtpspplqafnhylsapasmrrsaa--epagmspgiw---------iaqqlrrigDelnayyp-------------rr
--d-----c-------evmvpsaqgqqlygvtqaraevrgeeeqwarefvaertdma vfs----vfanfqedivrlw-s
ns-glqls-slieqqmdsslrahplslaps cmya -la lrsslevltgld kal  d hgvve             q 
rpca a q acaadh -m gkl  krgqga  rcp  --    da q c tr   f  k   l d             f 
qm              mc c k     p    a    rl                                         
                                                                                

       410       420       430       440    
....:....|....:....|....:....|....:....|....
                                            
lsl------r-ap--vllnllryllslgw---------------
vrsnsyvsr-q--wr--yr-imgmfrgvrrmrapemepngrrnl
rfqgnwqqhkpsvlmai-at-laivpfplhlllkaawll     
tmweeqpaaedh hlga - y----c---ghh l          
qkkrrrars r  ap   p  wpw -satqva            
 e                   sk   a a               
© 1998-2020Legal notice