Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaatraarprggvrwkvyrtvrssllpprrrslvaapltlrpspplclrwclsllpqrvwgssprvvvtrgppsrpw
          ma aaafgaqgcpaerggglagpagac  agc nlp gaaalhafrgdgngpparrkarlgrldagaear
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    .  .         ..                             
--------------makqPsdvssecdregrqlqpaerpP------qlrPG--------------aP-tsLqtepq----
tlrsegktrtwspq--meeqqcve-ledd--vftledgeagsgkhrgtqaasllsadlfaqslldcllsrshlfllgnpe
hhd  aemmsqplprers ped--saacslsrsgarssa       rqt                r gka gqqghstss
       alpkkhhggpg  a       gagp   g            a                l  d   d       
        cfcidef                                                                 
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--hgg-gdsclhgspqgplappaspgpfatrsplfifvrrssvlsrsssgyfsfdtdrspapmscdkstqtpsppcqafn
gn---e---------------------------------------------y--------l-a-fpavlplgeq-peg--
sh   a th cgpglrptsqedkatqtlspa  sqgvmlpcg teepqrlf-gnagy l -g-e---------- ---qw
                                         a et  rhss           t e egmeeeps fr   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .  .               :                                        
hylsamasmrqsqaepagmrpeiwiAq----eLrrigDeFnayy-----prrvnw-------------------------
qh------------------atvqpwrrygrkaqcqaaqlhrlhvqqptq----lilpfchrkevcleafpvlpskasqs
--tmwrrra srrspap al ny a l    c aamv a vdwlkgllrlnsls-wwyvstfmhplqvnprenrtwvrpp
asm       r   a       l             s   a sf   hqkk rrklrqslleltnhmslnqlmlyqppnv
 r                                             eneg nmtnpdqei d f arilef anpmllh
                                                    igm naiaa      lhg     igag 
                                                    afi                         
                                                     e                          
                                                     a                          

       330       340       350       360       370     
....:....|....:....|....:....|....:....|....:....|....:
                                                       
-------------------------------------------------------
aywttirdrswntccakaqriiseissgtrvplhstsrwpvvfvvrpsnvqdirl
strrrvqqsaisvrlrrglsrpeqlrfrsmp ampalpragllttlgeltlrppi
wsqpkrkgmwlrrnggq ggae kkpa egl          iessf dhqime  
krmhgqi fl e           a                 h pac aa hlc  
ciff k   g d                                      fi   
 f                                                     
                                                       
                                                       
© 1998-2022Legal notice