Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=185 residues).
MPARVCAPVSQAVDIVTVFCLGLRSLVPPSTKQKLCLYYFRKRDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTS
LQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQ
AAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=234 residues).
MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLCLLHCLRGDGQGPPGRRKARVGRRGAPSRAR
TLRSEGKARTKRDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R8MW85_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=420 residues).
RKPPALHRRPLRRVHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQCGRPASPHCASPQTPRGTLGWGRGEGGGSAL
GRLVWAHRCLGGLAGLFTNNGVRARQRPLAASATPGKRVDPGVPQPPKSGRGGGAARRGGHTQGARPLGAATGGGSRAVE
SAAPAGGGCAPATAGYWPRARLAGGAGARGGGGGGCDSGVGRLGPPWERACAGLWICRCLAWAPGSAMARARQEGSSPEP
VEGLARDGPRPFPLGRLVPSAVSCGLCESGLPATPAAPALLPAAYLCAPAAPPAVTAALGGPRWPGGPRSRPRGPRPDGP
QPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQPQHRPSPWRVLYN
LIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2R8MW85_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=131 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|F7FUT7_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=276 residues).
METPECAPVSGAGKTATHETKQVCRTAGGREAVNKPTGRTCSGSVANAIQTPVQHSALGVREAAPGAGRRGAGPGRGGAS
RSIRSRAGPRAADTTPLGWVADSAIIAATAAAAAAAAARGEMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDL
DPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLW
RSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|F7FUT7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=224 residues).
MPQGAVRHYPSPRGRLPPPTPPGTFLIYLSLVGLWGPSQQVCRWAPCPQFSPGPAPLLLSGSPRPEGGEMSEVRPLSSDI
FMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFV
LDRTDIGDVLSGVVDVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|F7GW45_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Callithrix jacchus GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|U3E722_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Callithrix jacchus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2020Legal notice