Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HZL0_BMF-02           --------------------------------------------------
F7HZL0_BMF-03           --------------------------------------------------
F7HZL0_BMF-01           ----------MPRAGVFWKQYRTVRSGLLPPRPASAVAAALCLRLPPPAA
U3F2S3_BAD-01           --------------------------------------------------
A0A2R8M6L7_BCL2L11      MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLC
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
                                                                          

F7HZL0_BMF-02           ----------------------------------------------MEPS
F7HZL0_BMF-03           ----------------------------------------------MEPS
F7HZL0_BMF-01           ARWAFSLLPNRVWASSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEPS
U3F2S3_BAD-01           --------------------------------------MFQIPEFEPSEQ
A0A2R8M6L7_BCL2L11      LLHCLRGDGQGPPGRRKARVGRRGAPSRARTLRSEGKARTKKDQMAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
U3E722_HRK-01           -------------------------------------MCPCPLHRGRGPP
                                                                          

F7HZL0_BMF-02           QCVEELEDD--VFQPEDGEP------GTQPGSLLSADLFAQSLLDCPLSR
F7HZL0_BMF-03           QCVEELEDD--VFQPEDGEP------GTQPGSLLSADLFAQSLLDCPLSR
F7HZL0_BMF-01           QCVEELEDD--VFQPEDGEP------GTQPGSLLSADLFAQSLLDCPLSR
U3F2S3_BAD-01           EDSSSAERGLSPSTAGDRPPGSGKHRRQAPG--------------LPGDA
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPP------QLRPG--------------AP-TS
U3E722_HRK-01           AV---CACSAGRLGLRSSAA------QLTAA--------------RL-KA
                                        .  .         ..                   

F7HZL0_BMF-02           LQLFPL-----------THCCGPGLRPTSQEDKATQTLSPASPSQGVMLP
F7HZL0_BMF-03           LQLFPL-----------THCCGPGLRPTSQEDKATQTLSPASPSQGVMLP
F7HZL0_BMF-01           LQLFPL-----------THCCGPGLRPTSQEDKATQTLSPASPSQGVMLP
U3F2S3_BAD-01           SHQQGQSTSSSHHGGAG---------------------------------
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A2R8M6L7_BCL2L11      LQTEPQ--------------------------------------------
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRR
A0A2R8M6L7_BCL2L11      LQTEPQ--------------------------------------------
U3E722_HRK-01           LGDELH--------------------------------------------
                                                                          

F7HZL0_BMF-02           CGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQH--------
F7HZL0_BMF-03           CGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQH--------
F7HZL0_BMF-01           CGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQH--------
U3F2S3_BAD-01           -AVETRSRHSSY-------PAGTEEDEGMEEEPSPFRG------------
A0A2R8M6L7_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      ----------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR
A0A2R8M6L7_BCL2L11      ----------------------------------------ASM------R
U3E722_HRK-01           ----------------------------------------QRTMWRRRAR
                                                                          

F7HZL0_BMF-02           ---------RAEVQIAR----KLQCIADQFHRLHVQQETE----------
F7HZL0_BMF-03           ---------RAEVQIAR----KLQCIADQFHRLHVQQLNK-----WRPIE
F7HZL0_BMF-01           ---------RAEVQIAR----KLQCIADQFHRLHVQQHQQNRNRMWWQVL
U3F2S3_BAD-01           RSRSAP----PNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGT-----
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRVMI-----
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRVNWILPFC
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRVNWILPFC
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRVNWILPFC
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRVFLNNYQA
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRISLLPD--
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRLEK-----
A0A2R8M6L7_BCL2L11      QSQAEPAGMRPEIWIAQ----ELRRIGDEFNAYY-----PRRLAKLLASS
U3E722_HRK-01           SRRAPAPGALPTYWPWL----CAAAQVAALAAWL-----LGRRNL-----
                                  .  .               :                    

F7HZL0_BMF-02           -----------------------------AWR------------------
F7HZL0_BMF-03           IRMTFLQRHNQEMPSWALNPKTRRRRQDFAWEVRGRQGLGREEKKRSGEG
F7HZL0_BMF-01           LFLHNLALNGEENRN-GAGPSFQPGQKGMLWN-------------PAGSR
U3F2S3_BAD-01           -------------ATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ------
A0A2R8M6L7_BCL2L11      ------LSLPPFLLTPPPPHCIFFKKRQSGLS------------------
A0A2R8M6L7_BCL2L11      HRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISALSFRTM
A0A2R8M6L7_BCL2L11      HRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISEI-----
A0A2R8M6L7_BCL2L11      HRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISEI-----
A0A2R8M6L7_BCL2L11      AEDHPHMVILRLLRYIVRLVWRMH--------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      T-------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
                                                                          

F7HZL0_BMF-02           -----------IEVTRPSHTIIC--
F7HZL0_BMF-03           VPAHSALPRAGLFSAFPD--FLPPL
F7HZL0_BMF-01           LPLH-------VFPSLPAAVLMERI
U3F2S3_BAD-01           -------------------------
A0A2R8M6L7_BCL2L11      -------------------------
A0A2R8M6L7_BCL2L11      PPLMPTSRWPVHLTVCGSLQHRI--
A0A2R8M6L7_BCL2L11      -----------------ENVQDI--
A0A2R8M6L7_BCL2L11      -----------------ENVQDI--
A0A2R8M6L7_BCL2L11      -------------------------
A0A2R8M6L7_BCL2L11      -------------------------
A0A2R8M6L7_BCL2L11      -------------------------
A0A2R8M6L7_BCL2L11      -------------------------
U3E722_HRK-01           -------------------------
                                                 

© 1998-2022Legal notice