Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      RKPPALHRRPLRRVHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQC
A0A2R8M6L7_BCL2L11      -------------------------------------------------M
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLC
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      GRPASPHCASPQTPRGTLGWGRGEGGGSALGRLVWAHRCLGGLAGLFTNN
A0A2R8M6L7_BCL2L11      PARVCAPVSQAVDIVTVFCLGL----------------------------
F7FUT7_BIK-02           --------METPECAPVSGAGK----------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      LLHCLRGDGQGPPGRRKARVGR----------------------------
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      GVRARQRPLAASATPGKRVDPGVPQPPKSGRGGGAARRGGHTQGARPLGA
A0A2R8M6L7_BCL2L11      --------------------RSLVPPSTKQKLCLYYFRKRDQMAKQPSDV
F7FUT7_BIK-02           --------------------TATHETKQVCRTAGGREAVNKPTGRTCSGS
F7FUT7_BIK-01           ------------------------------MPQGAVRHYPSPRGRLPPPT
A0A2R8M6L7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R8M6L7_BCL2L11      --------------------RGAPSRARTLRSEGKARTKRDQMAKQPSDV
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A2R8MW85_BBC3-02      -----------------MKCGVGSAWAC----------------------
A0A2R8MW85_BBC3-03      ATGGGSRAVESA-----APAGGGCAPATAGYWPRARLAGGAGARGGGGGG
A0A2R8M6L7_BCL2L11      SSEC-------------DREGRQLQPAE----------------------
F7FUT7_BIK-02           VANAIQTPVQHSALGVREAAPGAGRRGA----------------------
F7FUT7_BIK-01           PPGTFL--IYLSLVGLWGPSQQVCRWAP----------------------
A0A2R8M6L7_BCL2L11      SSEC-------------DREGRQLQPAE----------------------
A0A2R8M6L7_BCL2L11      SSEC-------------DREGRQLQPAE----------------------
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A2R8MW85_BBC3-02      ------------------------------PCQV----------------
A0A2R8MW85_BBC3-03      CDSGVGRLGPPWERACAGLWICRCLAWAPGSAMARARQEGSSPEPVEGLA
A0A2R8M6L7_BCL2L11      --------RPPQLRPGA-------------PTSLQTEPQ-----------
F7FUT7_BIK-02           --------GPGRGGASR-------------SIRSRAGPRAADTTPLGWVA
F7FUT7_BIK-01           --------CPQFSPGPA-------------PLLLSGSPRPEG--------
A0A2R8M6L7_BCL2L11      --------RPPQLRPGA-------------PTSLQTEPQGNPEGNHGGEG
A0A2R8M6L7_BCL2L11      --------RPPQLRPGA-------------PTSLQTEPQ-----------
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      RDGPRPFPLGRLVPSAVSCGLCESGLPATPAAPALLPAAYLCAPAAPPAV
A0A2R8M6L7_BCL2L11      --------------------------------------------------
F7FUT7_BIK-02           DSAIIAATAAAAAAAAARGEMSEVRPLSSDIFMETLLCEQFVDPLTMEVV
F7FUT7_BIK-01           ------------------GEMSEVRPLSSDIFMETLLCEQFVDPLTMEVV
A0A2R8M6L7_BCL2L11      DSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSF---
A0A2R8M6L7_BCL2L11      --------------------------------------------------
                                                                          

F7GW45_PMAIP1-01        -------------------------------------MPGKKARKSAQPS
U3E722_HRK-01           ------------------------------------MCPCPLHRGRGPPA
A0A2R8MW85_BBC3-02      ---------PRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGG
A0A2R8MW85_BBC3-03      TAALGGPRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGG
A0A2R8M6L7_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQA--E
F7FUT7_BIK-02           GGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
F7FUT7_BIK-01           GGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
A0A2R8M6L7_BCL2L11      -------DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQA--E
A0A2R8M6L7_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQA--E
                                                                          

F7GW45_PMAIP1-01        PARAPA-------DLEVECATQLRRFGDKLN-----------------FR
U3E722_HRK-01           VCACSAGRLGLRSSAAQLTAARLKALGDELH-----------------QR
A0A2R8MW85_BBC3-02      PTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYE--------------R
A0A2R8MW85_BBC3-03      PTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYE--------------R
A0A2R8M6L7_BCL2L11      PAGMRPEIW---------IAQELRRIGDEFNAYYP-------------RR
F7FUT7_BIK-02           VAMYSPGLA---------FVLDRTDIGDVLSGVVDVFANFQEDIVRLWRS
F7FUT7_BIK-01           VAMYSPGLA---------FVLDRTDIGDVLSGVVDVFANFQEDIVRLWRS
A0A2R8M6L7_BCL2L11      PAGMRPEIW---------IAQELRRIGDEFNAYYP-------------RR
A0A2R8M6L7_BCL2L11      PAGMRPEIW---------IAQELRRIGDEFNAYYP-------------RR
                             .                   :.* :                    

F7GW45_PMAIP1-01        QKL--------------LNLISKLFCSGT---------------
U3E722_HRK-01           TMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A2R8MW85_BBC3-02      RRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN-----
A0A2R8MW85_BBC3-03      RRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN-----
A0A2R8M6L7_BCL2L11      VFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH------------
F7FUT7_BIK-02           LSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK----------
F7FUT7_BIK-01           LSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK----------
A0A2R8M6L7_BCL2L11      LEK-----------------------------------------
A0A2R8M6L7_BCL2L11      VFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH------------
                                                                    

© 1998-2020Legal notice