Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GW45_PMAIP1-01        --------------------------------------------------
A0A8I3WL37_BBC3-02      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A8I3WL37_BBC3-03      --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A8I3W4Q3_BMF-01       ----------MPRAGVFWKQYRTVRSGLLPPRPASAVAAALCLRLPPPAA
A0A8I3W4Q3_BMF-02       --------------------------------------------------
A0A8I3W4Q3_BMF-03       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A8I3WL37_BBC3-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11      MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLC
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
                                                                          

F7GW45_PMAIP1-01        -------------------------------MPGKKARKSAQPSPARAPA
A0A8I3WL37_BBC3-02      ------------------------------MKCGVGSAWACPCQVPRASS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
U3E722_HRK-01           -------------------------------------MCPCPLHRGRGPP
A0A8I3WL37_BBC3-03      ------------------------------MKCGVGSAWACPCQVPRASS
F7FUT7_BIK-01           -----------------------------------------MSEVRPLSS
A0A8I3W4Q3_BMF-01       ARWAFSLLPNRVWASSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEPS
A0A8I3W4Q3_BMF-02       ----------------------------------------------MEPS
A0A8I3W4Q3_BMF-03       ----------------------------------------------MEPS
U3F2S3_BAD-01           --------------------------------------MFQIPEFEPSEQ
A0A8I3WL37_BBC3-01      ------------------------------MKCGVGSAWACPCQVPRASS
A0A2R8M6L7_BCL2L11      LLHCLRGDGQGPPGRRKARVGRRGAPSRARTLRSEGKARTKKDQMAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
                                                                          

F7GW45_PMAIP1-01        DLEVECAT------------------------------------------
A0A8I3WL37_BBC3-02      SVWVPCQMCETR---------GAAAAPPL---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
U3E722_HRK-01           AV---CACSAGR---------LGLRSSAA---------------------
A0A8I3WL37_BBC3-03      SVWVPCQMCGPQPSLSLAEQHLSPVPSAP---------------------
F7FUT7_BIK-01           DIFMETLLCEQF---------VDPLTM-----------------------
A0A8I3W4Q3_BMF-01       QCVEELEDD--V---------FQPEDGEP---------------------
A0A8I3W4Q3_BMF-02       QCVEELEDD--V---------FQPEDGEP---------------------
A0A8I3W4Q3_BMF-03       QCVEELEDD--V---------FQPEDGEP---------------------
U3F2S3_BAD-01           EDSSSAERGLSP---------STAGDRPP---------------------
A0A8I3WL37_BBC3-01      SVWVPCQMCGPR---------ERHGPRTPGGQLPGARRGLGPRRPAPLPA
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQ---------LQPAERPP---------------------
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
A0A8I3WL37_BBC3-02      -----------------------------------------ALEGPVQSH
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
U3E722_HRK-01           -----------------------------------------QLTAARLKA
A0A8I3WL37_BBC3-03      -----------------------------------------GALAGGPTQ
F7FUT7_BIK-01           -----------------------------------------EVVGGSDPE
A0A8I3W4Q3_BMF-01       -----------------------------------------GTQPGSLLS
A0A8I3W4Q3_BMF-02       -----------------------------------------GTQPGSLLS
A0A8I3W4Q3_BMF-03       -----------------------------------------GTQPGSLLS
U3F2S3_BAD-01           -----------------------------------GSGKHRRQAPGLP--
A0A8I3WL37_BBC3-01      WPPGALGRVLRPLRVRPARHPRRPRLAARCLPLRPRRPTRRHRRPGGPPL
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
A0A2R8M6L7_BCL2L11      -----------------------------------------QLRPGAPTS
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
A0A8I3WL37_BBC3-02      HGTPALSQGPQSP-------------------------------------
A0A2R8M6L7_BCL2L11      LQT--------EP-------------------------------------
U3E722_HRK-01           LGD--------EL-------------------------------------
A0A8I3WL37_BBC3-03      AAPGVRG-------------------------------------------
F7FUT7_BIK-01           EDLDPVEDPLECMENSDALALQLACIA-----------------------
A0A8I3W4Q3_BMF-01       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQ--EDKATQTLSPASPS
A0A8I3W4Q3_BMF-02       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQ--EDKATQTLSPASPS
A0A8I3W4Q3_BMF-03       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQ--EDKATQTLSPASPS
U3F2S3_BAD-01           ------GDASHQQGQSTSSSHHGG--------------------------
A0A8I3WL37_BBC3-01      AWGPPQPPPRPAPGRSSALALAGGAAPVARAQRPRGPGGRSHPGGPRSP-
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGS------PQGPLAPPASPGPFATRSPL
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGS------PQGPLAPPASPGPFATRSPL
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGS------PQGPLAPPASPGPFATRSPL
A0A2R8M6L7_BCL2L11      LQTEPQ--------------------------------------------
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGS------PQGPLAPPASPGPFATRSPL
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGS------PQGPLAPPASPGPFATRSPL
A0A2R8M6L7_BCL2L11      LQTEPQGNPEGNHGGEGDSCLHGS------PQGPLAPPASPGPFATRSPL
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
A0A8I3WL37_BBC3-02      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A8I3WL37_BBC3-03      --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
A0A8I3W4Q3_BMF-01       QGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQ-----
A0A8I3W4Q3_BMF-02       QGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQ-----
A0A8I3W4Q3_BMF-03       QGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQ-----
U3F2S3_BAD-01           --------------AGAVETRSRHSSYPAGTEEDEGMEEEPSPFR-----
A0A8I3WL37_BBC3-01      ----RGGGAVGPGDRGPAATDGGRPQRAVRAAETRGAAAAPPLALEGPVQ
A0A2R8M6L7_BCL2L11      FIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF-----
A0A2R8M6L7_BCL2L11      FIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF-----
A0A2R8M6L7_BCL2L11      FIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF-----
A0A2R8M6L7_BCL2L11      ----------------------DRSPAPMSCDKSTQTPSPPCQAF-----
A0A2R8M6L7_BCL2L11      FIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF-----
A0A2R8M6L7_BCL2L11      FIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF-----
A0A2R8M6L7_BCL2L11      FIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF-----
                                                                          

F7GW45_PMAIP1-01        -------------------------------------QLRRFGDKLNFRQ
A0A8I3WL37_BBC3-02      -GDGAQLGACTRPVDVRDLGG----RP--LPSP----DTLASAGDFLCTM
A0A2R8M6L7_BCL2L11      -QASM------RQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
U3E722_HRK-01           -HQRTMWRRRARSRRAPAPGA----LPTYWPWL----CAAAQVAALAAWL
A0A8I3WL37_BBC3-03      -------------------------EEEQWARE-IGAQLRRMADDLNALY
F7FUT7_BIK-01           -DQMDVSLRARRLAQLYEVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQ
A0A8I3W4Q3_BMF-01       -WQH---------------------RAEVQIAR----KLQCIADQFHRLH
A0A8I3W4Q3_BMF-02       -WQH---------------------RAEVQIAR----KLQCIADQFHRLH
A0A8I3W4Q3_BMF-03       -WQH---------------------RAEVQIAR----KLQCIADQFHRLH
U3F2S3_BAD-01           -GRSRSA------------------PPNLWAAQRYGRELRRMSDEFVDSF
A0A8I3WL37_BBC3-01      SHHGTPALSQGPQSPGDGAQLGACTRP-----V----DVRDLGGR-----
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
A0A2R8M6L7_BCL2L11      -NHYLSAMASMRQSQAEPAGM----RPEIWIAQ----ELRRIGDEFNAYY
                                                                          

F7GW45_PMAIP1-01        KLLNLISKLFCSGT------------------------------------
A0A8I3WL37_BBC3-02      --------------------------------------------------
A0A2R8M6L7_BCL2L11      PRRLAKLLASST--------------------------------------
U3E722_HRK-01           LGRRNL--------------------------------------------
A0A8I3WL37_BBC3-03      ERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN---------
F7FUT7_BIK-01           EDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK-------
A0A8I3W4Q3_BMF-01       VQ---------------QHQQNRNRMWWQVLLFLHNLALNGEENRNGAGP
A0A8I3W4Q3_BMF-02       VQ-------------------QETEAWRIEVTR-----------------
A0A8I3W4Q3_BMF-03       VQQLNKWRPIEIRMTFLQRHNQEMPSWALNPKTRRRRQDFAWEVRGRQGL
U3F2S3_BAD-01           -------------KGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGG
A0A8I3WL37_BBC3-01      -------------------PLPSPDTLASAGDFLCTM-------------
A0A2R8M6L7_BCL2L11      PRRVMI-----------LSLPPFLLTPPPPHCIFFKKRQSGLS-------
A0A2R8M6L7_BCL2L11      PRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQ
A0A2R8M6L7_BCL2L11      PRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQ
A0A2R8M6L7_BCL2L11      PRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQ
A0A2R8M6L7_BCL2L11      PRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH---------------
A0A2R8M6L7_BCL2L11      PRRISLLPD-----------------------------------------
A0A2R8M6L7_BCL2L11      PRRLEK--------------------------------------------
                                                                          

F7GW45_PMAIP1-01        ---------------------------------------
A0A8I3WL37_BBC3-02      ---------------------------------------
A0A2R8M6L7_BCL2L11      ---------------------------------------
U3E722_HRK-01           ---------------------------------------
A0A8I3WL37_BBC3-03      ---------------------------------------
F7FUT7_BIK-01           ---------------------------------------
A0A8I3W4Q3_BMF-01       SFQPGQKGMLWNPAGSRLP----LHVFPSLPAAVLMERI
A0A8I3W4Q3_BMF-02       ------------PSHTIIC--------------------
A0A8I3W4Q3_BMF-03       GREEKKRSGEGVPAHSALPRAGLFSAFPDFLPPL-----
U3F2S3_BAD-01           SAPSQ----------------------------------
A0A8I3WL37_BBC3-01      ---------------------------------------
A0A2R8M6L7_BCL2L11      ---------------------------------------
A0A2R8M6L7_BCL2L11      RIISALSFRTMPPLMPTSRWPVHLTVCGSLQHRI-----
A0A2R8M6L7_BCL2L11      RIISEI----------------------ENVQDI-----
A0A2R8M6L7_BCL2L11      RIISEI----------------------ENVQDI-----
A0A2R8M6L7_BCL2L11      ---------------------------------------
A0A2R8M6L7_BCL2L11      ---------------------------------------
A0A2R8M6L7_BCL2L11      ---------------------------------------
                                                               

© 1998-2023Legal notice