Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpragvfwkqyrtvrsgllpprpasavaaalclrlpppaaarwafsllpnrvwassprvlvtldpgaepwhhdseaetls
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      **************************************************************************
------MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLS
wshpge                                                                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************************************************  :
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQltq
                                                                             hqk
                                                                             ene

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        *                              :  : *   
-----w---------l-----e-------p---------aWr---------------g---p-h-------vfvtrPs--
nrnrm-wqvllrmtn-qrnnq-nrswgln-strrrrqgml nvrgrqglgreekkrs-srv-l-salpraglessl dhv
      rpieiflhf alhge mpn aag kfqpgqkdf  e             pa egl a        i paf aat

     
....:
::   
lmp--
ilerl
ficpi
© 1998-2022Legal notice