Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpragvfwkqyrtvrsgllpprpasavaaalclrlpppaaarwafsllpnrvwassprvlvtldpgaepwhhdseaetls
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      **************************************************************************
------MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLS
wshpge                                                                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************************    
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ----
                                                                            qlnk
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               :    *                                   *: : :                  
-----------q---qetrsWwqvvtt---------e-r---g-------------Pahsrlp-------fp--------
wrpieirmtfl-rqqnrnpm rlnplrrrrrqlngw-v-nrq-psrqpkqrsmlwv sgtiicragllsv--slpppvlm
            hhn  mea aielkflhnladfae n gga lgfeegkkggegn    a      fha  dflaal  

   
...
   
---
eri
   
© 1998-2023Legal notice