Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7HZL0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQVLLFLHNLALNGEENRNGAGPR
© 1998-2020Legal notice