Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HZL0_BMF-02      ------------------------------------------------------------
F7HZL0_BMF-03      ------------------------------------------------------------
F7HZL0_BMF-01      MPRAGVFWKQYRTVRSGLLPPRPASAVAAALCLRLPPPAAARWAFSLLPNRVWASSPRVL
                                                                               

F7HZL0_BMF-02      --------------------------MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADL
F7HZL0_BMF-03      --------------------------MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADL
F7HZL0_BMF-01      VTLDPGAEPWHHDSEAETLSWSHPGEMEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADL
                                             **********************************

F7HZL0_BMF-02      FAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
F7HZL0_BMF-03      FAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
F7HZL0_BMF-01      FAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
                   ************************************************************

F7HZL0_BMF-02      LFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQETE
F7HZL0_BMF-03      LFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQLNK
F7HZL0_BMF-01      LFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQ
                   *********************************************************  :

F7HZL0_BMF-02      ---------------------------------------AWR------------------
F7HZL0_BMF-03      -----WRPIEIRMTFLQRHNQEMPSWALNPKTRRRRQDFAWEVRGRQGLGREEKKRSGEG
F7HZL0_BMF-01      NRNRMWWQVLLFLHNLALNGEENRN-GAGPSFQPGQKGMLWN-------------PAGSR
                                                           *                   

F7HZL0_BMF-02      -----------IEVTRPSHTIIC--
F7HZL0_BMF-03      VPAHSALPRAGLFSAFPD--FLPPL
F7HZL0_BMF-01      LPLH-------VFPSLPAAVLMERI
                              :  : *   ::   

© 1998-2022Legal notice