Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8I3W4Q3_BMF-01      MPRAGVFWKQYRTVRSGLLPPRPASAVAAALCLRLPPPAAARWAFSLLPN
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A8I3W4Q3_BMF-03      --------------------------------------------------
                                                                         

A0A8I3W4Q3_BMF-01      RVWASSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEPSQCVEELEDDV
A0A8I3W4Q3_BMF-02      ------------------------------------MEPSQCVEELEDDV
A0A8I3W4Q3_BMF-03      ------------------------------------MEPSQCVEELEDDV
                                                           **************

A0A8I3W4Q3_BMF-01      FQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
A0A8I3W4Q3_BMF-02      FQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
A0A8I3W4Q3_BMF-03      FQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTS
                       **************************************************

A0A8I3W4Q3_BMF-01      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVL
A0A8I3W4Q3_BMF-02      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVL
A0A8I3W4Q3_BMF-03      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVL
                       **************************************************

A0A8I3W4Q3_BMF-01      PLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ--------------
A0A8I3W4Q3_BMF-02      PLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ--------------
A0A8I3W4Q3_BMF-03      PLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQLNKWRPIEIRMTF
                       ************************************              

A0A8I3W4Q3_BMF-01      -QHQQNRNRMWWQVLLFLHNLALNGEENRNGAGPSFQPGQKGMLWNPAGS
A0A8I3W4Q3_BMF-02      -----QETEAWRIEVTR-----------------------------PSHT
A0A8I3W4Q3_BMF-03      LQRHNQEMPSWALNPKTRRRRQDFAWEVRGRQGLGREEKKRSGEGVPAHS
                            :    *                                   *: :

A0A8I3W4Q3_BMF-01      RLP----LHVFPSLPAAVLMERI
A0A8I3W4Q3_BMF-02      IIC--------------------
A0A8I3W4Q3_BMF-03      ALPRAGLFSAFPDFLPPL-----
                        :                     

© 1998-2023Legal notice