Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaatraarargaargavgcpaersgglagrrglcaapgtlnpspglcllhclrgdgqgppgrrkarvgrrgapsrar
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *****************************************                         
--------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdsclhgspqgplap
tlrsegkartkkdq                                         -------------------------
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 ***************
paspgpfatrsplfifvrrssvlsrsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamASMRQSQAEPAGMRP
-----------------------------------------------------------------               
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************:                                                         
EIWIAQELRRIGDEFNAYYPRRvnwilp--------l---p-l-------------------------------------
                      lsl---fchrkevc-eaf-v-pskasqsaywttirdrsintccakaqriiseisfrtm
                      imklpysstedhphmvlprl rypvrpvwrmhkk qsgls           al     
                       finndqaa      sil f ltipplhciff                          
                       e   a                                                    
                       a                                                        

       330       340   
....:....|....:....|...
                       
-----------------------
pplmptsrwpvhltvcgenvqdi
                 slqhr 
                       
                       
                       
© 1998-2022Legal notice