Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaatraarargaargavgcpaersgglagrrglcaapgtlnpspglmplrvlrpvsqgvpivtvfrvgrrslvsrst
                                                 clahccagdg apdgrrkacl l gapppar
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *****************************************                         
--------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdsclhgspqgplap
tqrselyyrtkrdq                                         -------------------------
klklcgkafr                                                                      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   *********************************************
paspgpfatrsplfifvrrssvlsrsssgyfsfdtDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRP
-----------------------------------                                             
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************                                                          
EIWIAQELRRIGDEFNAYYPRRvnlnny-------c------l-------------------------------------
                      pfwilpqchrkhv-mvilrv-rykvsqvwywttirdrsintccakaqriiselsfrtm
                      lsk---faaedephleafplepsiarlsarmh                   ai     
                      ie lpqthgsvsa eiqsea iqd                                  
                       c e d                                                    

       330       340   
....:....|....:....|...
                       
-----------------------
pplmptsrwpvhltvcgsnvqri
                 elqhd 
                       
                       
© 1998-2022Legal notice