Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------cl------pp-----------------
mfpaaatraarargaargavgcpaersgglagrrmpcrvpgtvsqsvglvtvh--rlrsqv--strqkrvlyygapsrar
                                  glaaacaplnpapdicllf  ggdglg  grkkalcgrr       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *****************************************                         
----------krdqMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ-------------------------
tlrsegkart----                                         gnpegnhggegdsclhgspqgplap
        fr                                                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   *********************************************
-----------------------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRP
paspgpfatrsplfifvrrssvlsrsssgyfsfdt                                             
                                                                                

       250       260       270       280       290    
....:....|....:....|....:....|....:....|....:....|....
**********************:                               
EIWIAQELRRIGDEFNAYYPRRvflnnyqaaedhphmvilrllryivrlvwrmh
                      lek-----------------------------
                                                      
© 1998-2020Legal notice