Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLC
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
                                                                          

A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      LLHCLRGDGQGPPGRRKARVGRRGAPSRARTLRSEGKARTKKDQMAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
                                                                    ******

A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
                        ***********************************               

A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
A0A2R8M6L7_BCL2L11      ---------------------------------------------DRSPA
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
                                                                          

A0A2R8M6L7_BCL2L11      -------------------------ASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
                                                 *************************

A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRLAKLLASST-----------------------------
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVMI-----------LSLPPFLLTPPPPHCIFFKKRQSG
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRS
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRS
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRS
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH------
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRISLLPD--------------------------------
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRLEK-----------------------------------
                        ************:                                     

A0A2R8M6L7_BCL2L11      -------------------------------------------
A0A2R8M6L7_BCL2L11      LS-----------------------------------------
A0A2R8M6L7_BCL2L11      INTCCAKAQRIISALSFRTMPPLMPTSRWPVHLTVCGSLQHRI
A0A2R8M6L7_BCL2L11      INTCCAKAQRIISEI----------------------ENVQDI
A0A2R8M6L7_BCL2L11      INTCCAKAQRIISEI----------------------ENVQDI
A0A2R8M6L7_BCL2L11      -------------------------------------------
A0A2R8M6L7_BCL2L11      -------------------------------------------
A0A2R8M6L7_BCL2L11      -------------------------------------------
                                                                   

© 1998-2022Legal notice