Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8M6L7_BCL2L11      ----------------------------------MPARVCAPVSQAVDIV
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLC
                                                                          

A0A2R8M6L7_BCL2L11      TVFCLGLRSLVPPSTKQKLCLYY---------------FRKRDQMAKQPS
A0A2R8M6L7_BCL2L11      --------------------------------------------MAKQPS
A0A2R8M6L7_BCL2L11      LLHCLRGDGQGPPGRRKARVGRRGAPSRARTLRSEGKARTKRDQMAKQPS
                                                                    ******

A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCL
A0A2R8M6L7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
                        ***********************************               

A0A2R8M6L7_BCL2L11      ---------------------------------------------DRSPA
A0A2R8M6L7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPA
A0A2R8M6L7_BCL2L11      ---------------------------------------------DRSPA
                                                                     *****

A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
A0A2R8M6L7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRR
                        **************************************************

A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRLEK-----------------------------
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
                        ************:                               

© 1998-2020Legal notice