Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=291 residues).
MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLCLLHCLRGDGQGPPGRRKARVGRRGAPSRAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAP
PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRP
EIWIAQELRRIGDEFNAYYPRRVMILSLPPFLLTPPPPHCIFFKKRQSGLS
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=249 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISALSFRTMPPLMPTSRWPVHLT
VCGSLQHRI
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=227 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISEIENVQDI
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISE
IENVQDI
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLLPD
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRLA
KLLASST
© 1998-2022Legal notice