Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=185 residues).
MPARVCAPVSQAVDIVTVFCLGLRSLVPPSTKQKLCLYYFRKRDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTS
LQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQ
AAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2R8M6L7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=234 residues).
MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLCLLHCLRGDGQGPPGRRKARVGRRGAPSRAR
TLRSEGKARTKRDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
© 1998-2020Legal notice