Dataset for protein Puma of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                :**  ::                         
rkppalhrrplrrvhapgvsvralnprrrrsarpgglpgggdrsaggek  rgaaphcaspqtprgtlgwgrgegggsal

        90       100       110       120       130       140       150       160
    **  *                                                                       
grlv  cp lgglaglftnngvrarqrplaasatpgkrvdpgvpqppksgrgggaarrgghtqgarplgaatgggsrave

       170       180       190       200       210       220       230       240
saapagggcapatagywprarlaggagarggggggcdsgvgrlgppve  cagl icrclawapgsamararqegsspep

       250       260       270       280       290       300       310       320
                     *.* :*                                                   **
veglardgprpfplgrlvpsa p gl esglpatpaapallpaaylcapaappavtaalggprwpggprsrprgprpd  

       330       340       350       360       370       380       390       400

       410       420
© 1998-2020Legal notice