Dataset for protein Puma of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8I3WL37_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=130 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLSPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A8I3WL37_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=260 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPRERHGPRTPGGQLPGARRGLGPRRPAPLPAWPPGALGRVLRPLRVRPAR
HPRRPRLAARCLPLRPRRPTRRHRRPGGPPLAWGPPQPPPRPAPGRSSALALAGGAAPVARAQRPRGPGGRSHPGGPRSP
RGGGAVGPGDRGPAATDGGRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALSQGPQSPGDGAQLGACTRPVDVRDLG
GRPLPSPDTLASAGDFLCTM
>gnl|bcl2dbpro|A0A8I3WL37_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=101 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCETRGAAAAPPLALEGPVQSHHGTPALSQGPQSPGDGAQLGACTRPVDVRDL
GGRPLPSPDTLASAGDFLCTM
© 1998-2023Legal notice