Dataset for protein Puma of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8MW85_BBC3-03      RKPPALHRRPLRRVHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQC
A0A2R8MW85_BBC3-02      -----------------------------------------------MKC
A0A2R8MW85_BBC3-01      -----------------------------------------------MKC
                                                                        :*

A0A2R8MW85_BBC3-03      GRPASPHCASPQTPRGTLGWGRGEGGGSALGRLVWAHRCLGGLAGLFTNN
A0A2R8MW85_BBC3-02      GVGSA-----------------------------WACPC-----------
A0A2R8MW85_BBC3-01      GVGSA-----------------------------WACPC-----------
                        *  ::                             **  *           

A0A2R8MW85_BBC3-03      GVRARQRPLAASATPGKRVDPGVPQPPKSGRGGGAARRGGHTQGARPLGA
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-01      --------------------------------------------------
                                                                          

A0A2R8MW85_BBC3-03      ATGGGSRAVESAAPAGGGCAPATAGYWPRARLAGGAGARGGGGGGCDSGV
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-01      --------------------------------------------------
                                                                          

A0A2R8MW85_BBC3-03      GRLGPPWERACAGLWICRCLAWAPGSAMARARQEGSSPEPVEGLARDGPR
A0A2R8MW85_BBC3-02      -----QVPRASSSVW-----------------------------------
A0A2R8MW85_BBC3-01      -----QVPRASSSVW-----------------------------------
                                **.:.:*                                   

A0A2R8MW85_BBC3-03      PFPLGRLVPSAVSCGLCESGLPATPAAPALLPAAYLCAPAAPPAVTAALG
A0A2R8MW85_BBC3-02      -----------VPCQMC---------------------------------
A0A2R8MW85_BBC3-01      -----------VPCQMC---------------------------------
                                   *.* :*                                 

A0A2R8MW85_BBC3-03      GPRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGA-LAGGPTQA
A0A2R8MW85_BBC3-02      ------------------GPQPSLSLAEQHLESPVPSAPGA-LAGGPTQA
A0A2R8MW85_BBC3-01      ------------------GPR----------ERHGPRTPGGQLPGARRGL
                                          **.          *   * :**. *.*.    

A0A2R8MW85_BBC3-03      APGVRGEEEQWAR-EIGAQLR-------------RMADDLNALYERRRQE
A0A2R8MW85_BBC3-02      APGVRGEEEQWAR-EIGAQLR-------------RMADDLNALYERRRQE
A0A2R8MW85_BBC3-01      GPRRPAPLPAWPPGALGRVLRPLRVRPARHPRRPRLAARCLPLRPRRPTR
                        .*   .    *.   :*  **             *:*    .*  **   

A0A2R8MW85_BBC3-03      E--------------QPQHRPSPWR-VLYNLIMGLLP-------------
A0A2R8MW85_BBC3-02      E--------------QPQHRPSPWR-VLYNLIMGLLP-------------
A0A2R8MW85_BBC3-01      RHRRPGGPPLAWGPPQPPPRPAPGRSSALALAGGAAPGVARAQRPRGPGG
                                       **  **:* *     *  *  *             

A0A2R8MW85_BBC3-03      --FPRGHRAP----EMEPN-------------------------------
A0A2R8MW85_BBC3-02      --FPRGHRAP----EMEPN-------------------------------
A0A2R8MW85_BBC3-01      RSHPGGPRSPRGGGAVGPGDRGPAATDGGRPQRAVRAAETRGAAAAPPLA
                          .* * *:*     : *.                               

A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-01      LEGPVQSHHGTPALSQGPQSPGDGAQLGACTRPVDVRDLGGRPLPSPDTL
                                                                          

A0A2R8MW85_BBC3-03      ----------
A0A2R8MW85_BBC3-02      ----------
A0A2R8MW85_BBC3-01      ASAGDFLCTM
                                  

© 1998-2022Legal notice