Dataset for protein Puma of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8MW85_BBC3-03      RKPPALHRRPLRRVHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQC
A0A2R8MW85_BBC3-02      -----------------------------------------------MKC
                                                                        :*

A0A2R8MW85_BBC3-03      GRPASPHCASPQTPRGTLGWGRGEGGGSALGRLVWAHRCLGGLAGLFTNN
A0A2R8MW85_BBC3-02      GVGSA-----------------------------WACPC-----------
                        *  ::                             **  *           

A0A2R8MW85_BBC3-03      GVRARQRPLAASATPGKRVDPGVPQPPKSGRGGGAARRGGHTQGARPLGA
A0A2R8MW85_BBC3-02      --------------------------------------------------
                                                                          

A0A2R8MW85_BBC3-03      ATGGGSRAVESAAPAGGGCAPATAGYWPRARLAGGAGARGGGGGGCDSGV
A0A2R8MW85_BBC3-02      --------------------------------------------------
                                                                          

A0A2R8MW85_BBC3-03      GRLGPPWERACAGLWICRCLAWAPGSAMARARQEGSSPEPVEGLARDGPR
A0A2R8MW85_BBC3-02      -----QVPRASSSVW-----------------------------------
                                **.:.:*                                   

A0A2R8MW85_BBC3-03      PFPLGRLVPSAVSCGLCESGLPATPAAPALLPAAYLCAPAAPPAVTAALG
A0A2R8MW85_BBC3-02      -----------VPCQMC---------------------------------
                                   *.* :*                                 

A0A2R8MW85_BBC3-03      GPRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAA
A0A2R8MW85_BBC3-02      ------------------GPQPSLSLAEQHLESPVPSAPGALAGGPTQAA
                                          ********************************

A0A2R8MW85_BBC3-03      PGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQPQHRPSPWRVLYN
A0A2R8MW85_BBC3-02      PGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQPQHRPSPWRVLYN
                        **************************************************

A0A2R8MW85_BBC3-03      LIMGLLPFPRGHRAPEMEPN
A0A2R8MW85_BBC3-02      LIMGLLPFPRGHRAPEMEPN
                        ********************

© 1998-2020Legal notice