Dataset for protein Puma of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8I3WL37_BBC3-01      MKCGVGSAWACPCQVPRASSSVWVPCQMCGPRERHGPRTPGGQLPGARRG
A0A8I3WL37_BBC3-03      MKCGVGSAWACPCQVPRASSSVWVPCQMCGP-------------------
A0A8I3WL37_BBC3-02      MKCGVGSAWACPCQVPRASSSVWVPCQMCET-------------------
                        ***************************** .                   

A0A8I3WL37_BBC3-01      LGPRRPAPLPAWPPGALGRVLRPLRVRPARHPRRPRLAARCLPLRPRRPT
A0A8I3WL37_BBC3-03      --------------------------------------------------
A0A8I3WL37_BBC3-02      --------------------------------------------------
                                                                          

A0A8I3WL37_BBC3-01      RRHRRPGGPPLAWGPPQPPPRPAPGRSSALALAGGAAPVARAQRPRGPGG
A0A8I3WL37_BBC3-03      --------------------------------------------------
A0A8I3WL37_BBC3-02      --------------------------------------------------
                                                                          

A0A8I3WL37_BBC3-01      RSHPGGPRSPRGGGAVGPGDRGPAATDGGRPQRAVRAAETRGAAAAPPLA
A0A8I3WL37_BBC3-03      ----------------------------------------QPSLSLAEQH
A0A8I3WL37_BBC3-02      ----------------------------------------RGAAAAPPLA
                                                                . : : .   

A0A8I3WL37_BBC3-01      LEGPVQSHHGTPALSQGPQSPGDGA---------QLGACTRPV-------
A0A8I3WL37_BBC3-03      L-SPVPSAPG--ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A8I3WL37_BBC3-02      LEGPVQSHHGTPALSQGPQSPGDGA---------QLGACTRPV-------
                        * .** *  *  **: ** ... *.         ::**  * :       

A0A8I3WL37_BBC3-01      -DVRDLGGRPLPSPDTLASAGDFLCTM---------------
A0A8I3WL37_BBC3-03      YERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
A0A8I3WL37_BBC3-02      -DVRDLGGRPLPSPDTLASAGDFLCTM---------------
                         : *    .*   *..     :::  :               

© 1998-2023Legal notice