Dataset for protein classical BH3-containing proteins of organism Calidris pygmaea

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                              . 
-----------------------------------------------------------------------eqqdkatqt
mdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqsyscllgrfqlfplthccgpgirhp------vrk
                                                                       mlpgrtcke
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *. :  :  :        **:   .  :                       .                : : .*    
lsPssssqevmlpcgvteepRRl---ndgyrlhvppvgfaldphlqeepqegqrea------------ilnqlhrLhiqr
vt piappdrwvvqe----l  ifyggakwna---------------------krkraevqiarklqckadlfwk vlr-
aq aa ka ieiaa calq         efd syc rrvtfifl sislhtvs qe               h t  fcpe
                                                                                

       170       180       190       200
....:....|....:....|....:....|....:....|
                                        
----------------------------------------
vqqnrnqvwwqwwlfssplvvnwktrsrhtlsrplskaad
t    gcl rglfg lhngallaeanrn qgq        
h                                       
© 1998-2022Legal notice