Dataset for protein classical BH3-containing proteins of organism Calidris pygmaea

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3KIN9_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C3KIN9_BMF-02       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C3JPH7_PMAIP1-      --------------------------------------------------
A0A8C3JX57_BCL2L11      --------------------------------------------------
                                                                          

A0A8C3KIN9_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C3KIN9_BMF-02       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C3JPH7_PMAIP1-      ---------------------MLPGRTVRKATPPAAPAEREVVAECALQL
A0A8C3JX57_BCL2L11      ---------------------------CKEVQPAISKPEIWIAQE----L
                                                    .   *. :  :  :        

A0A8C3KIN9_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C3KIN9_BMF-02       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C3JPH7_PMAIP1-      RRI---GDKWDL---------------------RQK------------IL
A0A8C3JX57_BCL2L11      RRI---GDEFNASYCPRRVTFIFLLSISLHTVSKRE------------KL
                        **:   .  :                       .                

A0A8C3KIN9_BMF-01       DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR-------
A0A8C3KIN9_BMF-02       DQFHRLHIQRV----GCLWRGWWGFSSPGVVLWKTRSRHQLSRPLSKAAD
A0A8C3JPH7_PMAIP1-      NLLTKLFCPET---------------------------------------
A0A8C3JX57_BCL2L11      NHLWKLVLR-----------------------------------------
                        : : .*                                            

© 1998-2022Legal notice