Dataset for protein classical BH3-containing proteins of organism Calidris pygmaea

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3JPH7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Calidris pygmaea GN=PMAIP1 (length=54 residues).
MLPGRTVRKATPPAAPAEREVVAECALQLRRIGDKWDLRQKILNLLTKLFCPET
>gnl|bcl2dbpro|A0A8C3JX57_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Calidris pygmaea GN=BCL2L11 (length=63 residues).
CKEVQPAISKPEIWIAQELRRIGDEFNASYCPRRVTFIFLLSISLHTVSKREKLNHLWKLVLR
>gnl|bcl2dbpro|A0A8C3KIN9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Calidris pygmaea GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A8C3KIN9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Calidris pygmaea GN=BMF (length=196 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
VGCLWRGWWGFSSPGVVLWKTRSRHQLSRPLSKAAD
© 1998-2022Legal notice