Dataset for protein Bmf of organism Calidris pygmaea

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
                                                                                

       170       180       190       200
....:....|....:....|....:....|....:....|
     . :*.  : *    .:  ::. .*  .*       
v----nqvWwqwwlFssplvvnwktrsrHtlsR-------
hqqnrgcl rglfg lhngallaeanrn qgq plskaad
© 1998-2022Legal notice